KEGG   Homo sapiens (human): 10291
Entry
10291             CDS       T01001                                 
Symbol
SF3A1, PRP21, PRPF21, SAP114, SF3A120
Name
(RefSeq) splicing factor 3a subunit 1
  KO
K12825  splicing factor 3A subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10291 (SF3A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10291 (SF3A1)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    10291 (SF3A1)
 Complex B
    10291 (SF3A1)
 Complex C
   U2 SnRNP specific factors
    10291 (SF3A1)
SSDB
Motif
Pfam: PRP21_like_P Surp ubiquitin Ubiquitin_2 Rad60-SLD
Other DBs
NCBI-GeneID: 10291
NCBI-ProteinID: NP_005868
OMIM: 605595
HGNC: 10765
Ensembl: ENSG00000099995
Pharos: Q15459(Tbio)
UniProt: Q15459 A0A024R1K8
Structure
LinkDB
Position
22:complement(30331988..30356894)
AA seq 793 aa
MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFV
ARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQ
QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQ
FLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVL
DQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTT
PEELGARILIQERYEKFGESEEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSD
DEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKI
PASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVE
ETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDD
TKEKIGPSKPNEIPQQPPPPSSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRP
PMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMAPRPPPMIVPTAFVPAPPVAP
VPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEW
KLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAV
IHLALKERGGRKK
NT seq 2382 nt   +upstreamnt  +downstreamnt
atgccggccggacccgtgcaggcggtgcccccgccgccgcccgtgcccacggagcccaaa
cagcccacagaagaagaagcatcttcaaaggaggattctgcaccttctaagccagttgtg
gggattatttaccctcctccagaggtcagaaatattgttgacaagactgccagctttgtg
gccagaaacgggcctgaatttgaagctaggatccgacagaacgagatcaacaaccccaag
ttcaactttctgaaccccaatgacccttaccatgcctactaccgccacaaggtcagcgag
ttcaaggaagggaaggctcaggagccgtccgccgccatccccaaggtcatgcagcagcag
cagcagaccacccagcagcagctgccccagaaggtccaagcccaagtaatccaagagacc
atcgtgcccaaagagcctcctcctgagtttgagttcattgctgatcctccctctatctca
gccttcgacttggatgtggtgaagctgacggctcagtttgtggccaggaatgggcgccag
tttctgacccagctgatgcagaaagagcagcgcaactaccagtttgactttctccgccca
cagcacagcctcttcaactacttcacgaagctagtggaacagtacaccaagatcttgatt
ccacccaaaggtttattttcaaagctcaagaaagaggctgaaaacccccgagaagttttg
gatcaggtgtgttaccgagtggaatgggccaaattccaggaacgtgagaggaagaaggaa
gaagaggagaaggagaaggagcgggtggcctatgctcagatcgactggcatgattttgtg
gtggtggaaacagtggacttccaacccaatgagcaagggaacttccctccccccaccacg
ccagaggagctgggggcccgaatcctcattcaggagcgctatgaaaagtttggggagagt
gaggaagttgagatggaggtcgagtctgatgaggaggatgacaaacaggagaaggcggag
gagcctccttcccagctggaccaggacacccaagtacaagatatggatgagggttcagat
gatgaagaagaagggcagaaagtgcccccacccccagagacacccatgcctccacctctg
cccccaactccagaccaagtcattgtccgcaaggattatgatcccaaagcctccaagccc
ttgcctccagcccctgctccagatgagtatcttgtgtcccccattactggggagaagatc
cccgccagcaaaatgcaggaacacatgcgcattggacttcttgaccctcgctggctggag
cagcgggatcgctccatccgtgagaagcagagcgatgatgaggtgtacgcaccaggtctg
gatattgagagcagcttgaagcagttggctgagcggcgtactgacatcttcggtgtagag
gaaacagccattggtaagaagatcggtgaggaggagatccagaagccagaggaaaaggtg
acctgggatggccactcaggcagcatggcccggacccagcaggctgcccaggccaacatc
accctccaggagcagattgaggccattcacaaggccaaaggcctggtgccagaggatgac
actaaagagaagattggccccagcaagcccaatgaaatccctcaacagccaccgccacca
tcttcagccaccaacatccccagctcggctccacccatcacttcagtgccccgaccaccc
acaatgccacctccagttcgtactacagttgtctccgcagtacccgtcatgccccggccc
ccaatggcatctgtggtccggctgcccccaggctcagtgatcgcccccatgccgcccatc
atccacgcgcccagaatcaacgtggtgcccatgcctccctcggcccctcctattatggcc
ccccgcccaccccccatgattgtgccaacagcctttgtgcctgctccacctgtggcacct
gtcccagctccagccccaatgccccctgtgcatcccccacctcccatggaagatgagccc
acctccaaaaaactgaagacagaggacagcctcatgccagaggaggagttcctgcgcaga
aacaagggtccagtgtccatcaaagtccaggtgcccaacatgcaggataagacggaatgg
aaactgaatgggcaggtgctggtcttcaccctcccactcacggaccaggtctctgtcatt
aaggtgaagattcatgaagccacaggcatgcctgcagggaaacagaagctacagtatgag
ggtatcttcatcaaagattccaactcactggcttactacaacatggccaatggcgcagtc
atccacctggccctcaaggagagaggcgggaggaagaagtag

KEGG   Homo sapiens (human): 10946
Entry
10946             CDS       T01001                                 
Symbol
SF3A3, PRP9, PRPF9, SAP61, SF3a60
Name
(RefSeq) splicing factor 3a subunit 3
  KO
K12827  splicing factor 3A subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10946 (SF3A3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10946 (SF3A3)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    10946 (SF3A3)
 Complex B
    10946 (SF3A3)
 Complex C
   U2 SnRNP specific factors
    10946 (SF3A3)
SSDB
Motif
Pfam: SF3a60_Prp9_C SDE2_2C SF3A3 SF3a60_bindingd zf-met
Other DBs
NCBI-GeneID: 10946
NCBI-ProteinID: NP_006793
OMIM: 605596
HGNC: 10767
Ensembl: ENSG00000183431
Pharos: Q12874(Tbio)
UniProt: Q12874
Structure
LinkDB
Position
1:complement(37956975..37990022)
AA seq 501 aa
METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDL
YDDKDGLRKEELNAISGPNEFAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENP
SEEAQNLVEFTDEEGYGRYLDLHDCYLKYINLKASEKLDYITYLSIFDQLFDIPKERKNA
EYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQAEFEKKWENGTFPGWPKETSSALTHA
GAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKGKSLESLDTSL
FAKNPKSKGTKRDTERNKDIAFLEAQIYEYVEILGEQRHLTHENVQRKQARTGEEREEEE
EEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPK
AFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYE
DSSGNVVNKKTYEDLKRQGLL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggagacaatactggagcagcagcggcgctatcatgaggagaaggaacggctcatggac
gtcatggctaaagagatgctcaccaagaagtccacgctccgggaccagatcaattctgat
caccgcactcgggccatgcaagataggtatatggaggtcagtgggaacctgagggatttg
tatgatgataaggatggattacgaaaggaggagctcaatgccatttcaggacccaatgag
tttgctgaattctataatagactcaagcaaataaaggaattccaccggaagcacccaaat
gagatctgtgtgccaatgtcagtggaatttgaggaactcctgaaggctcgagagaatcca
agtgaagaggcacaaaacttggtggagttcacagatgaagagggatatggtcgttatctc
gatctccatgactgttacctcaagtacattaacctgaaggcatctgagaagctggattat
atcacatacctgtccatctttgaccaattatttgacattcctaaagaaaggaagaatgca
gagtataagagatacctagagatgctgcttgagtaccttcaggattacacagatagagtg
aagcctctccaagatcagaatgaactttttgggaagattcaggctgagtttgagaagaaa
tgggagaatgggacctttcctggatggccgaaagagacaagcagtgccctgacccatgct
ggagcccatcttgacctctctgcattctcctcctgggaggagttggcttctctgggtttg
gacagattgaaatctgctctcttagctttaggcttgaaatgtggcgggaccctagaagag
cgagcccagagactattcagtaccaaaggaaagtccctggagtcacttgatacctctttg
tttgccaaaaatcccaagtcaaagggcaccaagcgagacactgaaaggaacaaagacatt
gcttttctagaagcccagatctatgaatatgtagagattctcggggaacagcgacatctc
actcatgaaaatgtacagcgcaagcaagccaggacaggagaagagcgagaagaagaggaa
gaagagcagatcagtgagagtgagagtgaagatgaagagaacgagatcatttacaacccc
aaaaacctgccacttggctgggatggcaaacctattccctactggctgtataagcttcat
ggcctaaatatcaactacaactgtgagatttgtggaaactacacctaccgagggcccaaa
gccttccagcgacactttgctgaatggcgtcatgctcatggcatgaggtgtttgggcatc
ccaaacactgctcactttgctaatgtgacacagattgaagatgctgtctccttgtgggcc
aaactgaaattgcagaaggcttcagaacgatggcagcctgacactgaggaagaatatgaa
gactcaagtgggaatgttgtgaataagaagacatacgaggatctgaaaagacaaggactg
ctctag

KEGG   Homo sapiens (human): 8175
Entry
8175              CDS       T01001                                 
Symbol
SF3A2, PRP11, PRPF11, SAP62, SF3a66
Name
(RefSeq) splicing factor 3a subunit 2
  KO
K12826  splicing factor 3A subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    8175 (SF3A2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    8175 (SF3A2)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    8175 (SF3A2)
 Complex B
    8175 (SF3A2)
 Complex C
   U2 SnRNP specific factors
    8175 (SF3A2)
SSDB
Motif
Pfam: SF3A2 zf-met CactinC_cactus TUTase PRP4
Other DBs
NCBI-GeneID: 8175
NCBI-ProteinID: NP_009096
OMIM: 600796
HGNC: 10766
Ensembl: ENSG00000104897
Pharos: Q15428(Tbio)
UniProt: Q15428 Q05DF2
Structure
LinkDB
Position
19:2236824..2248655
AA seq 464 aa
MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL
TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVT
KQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIA
FKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNG
LPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASG
VHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPP
APGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPG
VHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggacttccagcatcgccccgggggcaagaccgggagcgggggcgtggcctcctcctcc
gagagcaaccgtgaccgcagggagcgcctccggcagctggccctggagaccatcgacatc
aacaaggacccgtacttcatgaagaaccacctgggctcctatgaatgcaaactctgcctg
acacttcacaacaatgaggggagctacctggcacatacgcaggggaagaagcaccagacc
aacctggcccggcgagcagccaaggaggccaaggaggcccctgcccagcccgcgcctgag
aaggtcaaggtggaggtgaagaagtttgtgaagatcggccgcccgggctacaaagtgacc
aagcagagagactcggagatgggccagcagagcctcctcttccagattgactaccctgag
atcgccgagggcatcatgccacgtcaccgcttcatgtctgcgtacgagcagaggatcgag
cctccggaccggcgctggcagtacctgctcatggccgccgagccctacgagaccattgcc
ttcaaggtgccgagcagagagatcgacaaggcggagggcaagttctggacacactggaac
cgggagaccaagcagttcttcctccagttccactttaagatggagaagcccccggctcca
cccagcctccctgctggcccccctggggtgaagcggcctccacccccgctgatgaacggt
ctgccccctcggccaccgctgcctgagtctttgccaccgcccccgccaggaggcctgcct
ctgccacccatgccccccacagggcctgcgccctcagggcccccgggaccaccccagcta
cccccgccagctccaggggtccaccccccggccccagtggtgcatccccctgcatctggg
gtccatcccccagctcctggcgtccaccccccagctcctggcgtccatcccccagcccct
ggggtccacccaccaacctctggggtccaccccccagctcctggagtccaccctccagcc
cccggggttcacccaccagcccccggagtccacccaccagcccctggggttcacccacca
gccccaggggtccatcctcccccatcagcgggggttcacccccaggccccgggggtgcac
ccagcagcccccgccgttcaccctcaggccccaggggtgcacccaccagccccagggatg
caccctcaggccccgggggtccacccccaacctcccggggtccatccgtcggctcctggg
gtccaccctcagcctccgggagttcacccctcaaatcctggggtgcaccccccaactccc
atgcccccaatgctgaggcccccacttccctccgaaggcccagggaacatacctccccct
cccccaaccaactga

DBGET integrated database retrieval system