KEGG   Homo sapiens (human): 10560
Entry
10560             CDS       T01001                                 
Symbol
SLC19A2, TC1, THMD1, THT1, THTR1, TRMA
Name
(RefSeq) solute carrier family 19 member 2
  KO
K14610  solute carrier family 19 (thiamine transporter), member 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04977  Vitamin digestion and absorption
Disease
H01183  Thiamine-responsive megaloblastic anemia
H01565  Wernicke encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    10560 (SLC19A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10560 (SLC19A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC19: Folate/thiamine transporter
   10560 (SLC19A2)
SSDB
Motif
Pfam: Folate_carrier MFS_1
Other DBs
NCBI-GeneID: 10560
NCBI-ProteinID: NP_008927
OMIM: 603941
HGNC: 10938
Ensembl: ENSG00000117479
Pharos: O60779(Tbio)
UniProt: O60779 A0A024R928
LinkDB
Position
1:complement(169463909..169485970)
AA seq 497 aa
MDVPGPVSRRAAAAAATVLLRTARVRRECWFLPTALLCAYGFFASLRPSEPFLTPYLLGP
DKNLTEREVFNEIYPVWTYSYLVLLFPVFLATDYLRYKPVVLLQGLSLIVTWFMLLYAQG
LLAIQFLEFFYGIATATEIAYYSYIYSVVDLGMYQKVTSYCRSATLVGFTVGSVLGQILV
SVAGWSLFSLNVISLTCVSVAFAVAWFLPMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTD
TPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWNDFLMCYSSRPLLCWSV
WWALSTCGYFQVVNYTQGLWEKVMPSRYAAIYNGGVEAVSTLLGAVAVFAVGYIKISWST
WGEMTLSLFSLLIAAAVYIMDTVGNIWVCYASYVVFRIIYMLLITIATFQIAANLSMERY
ALVFGVNTFIALALQTLLTLIVVDASGLGLEITTQFLIYASYFALIAVVFLASGAVSVMK
KCRKLEDPQSSSQVTTS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggatgtgcccggcccggtgtctcggcgggcggcggcggcggcggccactgtgctcctg
cggaccgctcgggtccgtcgcgaatgctggttcttgccgaccgcgctgctctgcgcctac
ggcttcttcgccagcctcaggccgtccgagcccttcctgaccccgtacctgctggggccg
gacaagaacctgaccgagagggaggtcttcaatgaaatttatccagtatggacttactct
tacctggtgctactgtttcctgtgttccttgccacagactacctccgttataaacctgtt
gttctactgcaggggctcagccttattgttacatggtttatgctgctctatgcccaggga
ctgctggccattcaatttctagaatttttttatggcatcgccacagccactgaaattgcc
tattactcttatatctacagtgtggtggacctgggcatgtaccagaaagtcacaagttac
tgtcgaagtgccactttggtgggctttacagtgggctctgtcctagggcaaatccttgtc
tcagtggcaggctggtcgctgttcagcctgaatgtcatctctcttacctgtgtttcagtg
gcttttgctgtggcctggtttttacctatgccacagaagagcctcttctttcaccacatt
ccttctacctgccagagagtgaatggcatcaaggtacaaaatggtggcattgttactgac
accccagcttctaaccaccttcctggctgggaggacattgagtcaaaaatccctctaaat
atggaggagcctcccgtggaggaaccggaacccaagccagaccgtctccttgtattgaaa
gtactatggaatgatttcctgatgtgctactcctctcgccctcttctctgctggtctgtg
tggtgggccctctctacctgtggctattttcaagttgtgaactacacacagggcctgtgg
gagaaagtgatgccttctcgctatgctgctatctataatggtggcgtggaggccgtttca
accttactgggtgctgttgctgtgtttgcagttggttatataaaaatatcctggtcaact
tggggagaaatgacattatctctcttttctctcctgattgctgctgcagtgtatatcatg
gacactgtgggtaacatttgggtgtgctatgcatcctatgttgtcttcagaatcatctac
atgttactcatcacgatagcaacttttcaaattgctgcaaacctcagcatggaacgctat
gccctagtatttggtgtaaataccttcattgccctggcactgcagacgctgctcactcta
attgtggtagatgccagtggccttggattagaaattaccactcagtttttgatctatgcc
agttattttgcactcatcgctgtggttttcctggccagtggtgcagtcagtgttatgaag
aaatgtagaaagctggaagatccacaatcaagttctcaagtaaccacttcataa

DBGET integrated database retrieval system