KEGG   Homo sapiens (human): 10631Help
Entry
10631             CDS       T01001                                 

Gene name
POSTN, OSF-2, OSF2, PDLPOSTN, PN
Definition
(RefSeq) periostin
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Fasciclin
Motif
Other DBs
NCBI-GeneID: 10631
NCBI-ProteinID: NP_006466
OMIM: 608777
HGNC: 16953
Ensembl: ENSG00000133110
Vega: OTTHUMG00000016751
Pharos: Q15063(Tbio)
UniProt: Q15063 A0A024RDS2
LinkDB All DBs
Structure
PDB: 

Position
13q13.3
AA seq 836 aa AA seqDB search
MIPFLPMFSLLLLLIVNPINANNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTC
KNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDAS
KLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLK
NGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDF
IEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL
MKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKDIVTNNGVIHL
IDQVLIPDSAKQVIELAGKQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLSM
DQRLLKLILQNHILKVKVGLNELYNGQILETIGGKQLRVFVYRTAVCIENSCMEKGSKQG
RNGAIHIFREIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDA
FKGMTSEEKEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVND
TLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGST
FKEIPVTVYTTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETI
TEVIHGEPIIKKYTKIIDGVPVEITEKETREERIITGPEIKYTRISTGGGETEETLKKLL
QEEVTKVTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgattccctttttacccatgttttctctactattgctgcttattgttaaccctataaac
gccaacaatcattatgacaagatcttggctcatagtcgtatcaggggtcgggaccaaggc
ccaaatgtctgtgcccttcaacagattttgggcaccaaaaagaaatacttcagcacttgt
aagaactggtataaaaagtccatctgtggacagaaaacgactgtgttatatgaatgttgc
cctggttatatgagaatggaaggaatgaaaggctgcccagcagttttgcccattgaccat
gtttatggcactctgggcatcgtgggagccaccacaacgcagcgctattctgacgcctca
aaactgagggaggagatcgagggaaagggatccttcacttactttgcaccgagtaatgag
gcttgggacaacttggattctgatatccgtagaggtttggagagcaacgtgaatgttgaa
ttactgaatgctttacatagtcacatgattaataagagaatgttgaccaaggacttaaaa
aatggcatgattattccttcaatgtataacaatttggggcttttcattaaccattatcct
aatggggttgtcactgttaattgtgctcgaatcatccatgggaaccagattgcaacaaat
ggtgttgtccatgtcattgaccgtgtgcttacacaaattggtacctcaattcaagacttc
attgaagcagaagatgacctttcatcttttagagcagctgccatcacatcggacatattg
gaggcccttggaagagacggtcacttcacactctttgctcccaccaatgaggcttttgag
aaacttccacgaggtgtcctagaaaggatcatgggagacaaagtggcttccgaagctctt
atgaagtaccacatcttaaatactctccagtgttctgagtctattatgggaggagcagtc
tttgagacgctggaaggaaatacaattgagataggatgtgacggtgacagtataacagta
aatggaatcaaaatggtgaacaaaaaggatattgtgacaaataatggtgtgatccatttg
attgatcaggtcctaattcctgattctgccaaacaagttattgagctggctggaaaacag
caaaccaccttcacggatcttgtggcccaattaggcttggcatctgctctgaggccagat
ggagaatacactttgctggcacctgtgaataatgcattttctgatgatactctcagcatg
gatcagcgcctccttaaattaattctgcagaatcacatattgaaagtaaaagttggcctt
aatgagctttacaacgggcaaatactggaaaccatcggaggcaaacagctcagagtcttc
gtatatcgtacagctgtctgcattgaaaattcatgcatggagaaagggagtaagcaaggg
agaaacggtgcgattcacatattccgcgagatcatcaagccagcagagaaatccctccat
gaaaagttaaaacaagataagcgctttagcaccttcctcagcctacttgaagctgcagac
ttgaaagagctcctgacacaacctggagactggacattatttgtgccaaccaatgatgct
tttaagggaatgactagtgaagaaaaagaaattctgatacgggacaaaaatgctcttcaa
aacatcattctttatcacctgacaccaggagttttcattggaaaaggatttgaacctggt
gttactaacattttaaagaccacacaaggaagcaaaatctttctgaaagaagtaaatgat
acacttctggtgaatgaattgaaatcaaaagaatctgacatcatgacaacaaatggtgta
attcatgttgtagataaactcctctatccagcagacacacctgttggaaatgatcaactg
ctggaaatacttaataaattaatcaaatacatccaaattaagtttgttcgtggtagcacc
ttcaaagaaatccccgtgactgtctatacaactaaaattataaccaaagttgtggaacca
aaaattaaagtgattgaaggcagtcttcagcctattatcaaaactgaaggacccacacta
acaaaagtcaaaattgaaggtgaacctgaattcagactgattaaagaaggtgaaacaata
actgaagtgatccatggagagccaattattaaaaaatacaccaaaatcattgatggagtg
cctgtggaaataactgaaaaagagacacgagaagaacgaatcattacaggtcctgaaata
aaatacactaggatttctactggaggtggagaaacagaagaaactctgaagaaattgtta
caagaagaggtcaccaaggtcaccaaattcattgaaggtggtgatggtcatttatttgaa
gatgaagaaattaaaagactgcttcagggagacacacccgtgaggaagttgcaagccaac
aaaaaagttcaaggatctagaagacgattaagggaaggtcgttctcagtga

DBGET integrated database retrieval system