KEGG   Homo sapiens (human): 10840
Entry
10840             CDS       T01001                                 

Gene name
ALDH1L1, 10-FTHFDH, 10-fTHF, FDH, FTHFD
Definition
(RefSeq) aldehyde dehydrogenase 1 family member L1
  KO
K00289  formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    10840 (ALDH1L1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     10840 (ALDH1L1)
SSDB
Motif
Pfam: Aldedh Formyl_trans_N Formyl_trans_C PP-binding DUF1487
Other DBs
NCBI-GeneID: 10840
NCBI-ProteinID: NP_036322
OMIM: 600249
HGNC: 3978
Ensembl: ENSG00000144908
Vega: OTTHUMG00000125551
Pharos: O75891(Tbio)
UniProt: O75891 Q53H87
LinkDB
Structure
PDB: 
2CFI 2BW0 2CQ8

Position
3q21.3
AA seq 902 aa
MKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKYSRWR
AKGQALPDVVAKYQALGAELNVLPFCSQFIPMEIISAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAV
RLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACEQ
KLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLEDGKMI
LASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKSGAASVDVVRL
VEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRM
PHQLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENGRWGKI
SARDRGRLMYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QGSTIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQ
VTPLTALKFAELTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMK
SCAISNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEDSIH
DEFVRRVVEEVRKMKVGNPLDRDTDHGPQNHHAHLVKLMEYCQHGVKEGATLVCGGNQVP
RPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFT
RDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTF
EY
NT seq 2709 nt   +upstreamnt  +downstreamnt
atgaagattgcagtgattggacagagcctgtttggccaggaagtttactgccacctgagg
aaggagggccacgaagtggtgggtgtgttcactgttccagacaaggatggaaaggccgac
cccctgggtctggaagctgagaaggatggagtgccggtattcaagtactcccggtggcgt
gcaaaaggacaggctttgcctgatgtggtggcaaaataccaggctttgggggccgagctc
aacgtcctgcccttctgcagccaattcatccccatggagataatcagtgccccccggcat
ggctccatcatctatcacccgtcactgctccctaggcaccgaggggcctcggccatcaac
tggaccctcattcacggagataagaaaggggggttttccatcttctgggcggatgatggt
ctggacaccggagacctgctgctgcagaaggagtgtgaggtgctcccggacgacaccgtg
agcacgctgtacaaccgcttcctcttccctgaaggcatcaaagggatggtgcaggccgtg
aggctgatcgctgagggcaaagcccccagactccctcagcctgaggaaggagccacctat
gaggggattcagaagaaggagacagccaagatcaactgggaccagccggcagaggccatt
cacaactggatccgcgggaacgacaaggtgccgggagcctggacagaggcctgtgaacag
aaactgacatttttcaactcaacgctgaacacttcaggcctggtgcccgagggagacgct
ttgcccatcccaggagcccatcggccaggggtggtcaccaaagcaggactcatcctcttt
gggaatgatgacaaaatgctgctggtgaagaatattcagctggaggatggcaaaatgatc
ctggcctcgaacttctttaagggggcagccagcagtgtccttgagctgacagaggcagag
ctggttactgcggaggctgtgcggagtgtttggcagcggatcctccccaaagtcctggag
gttgaagactccactgatttcttcaagtcaggggccgcgtctgtggacgttgtgaggctg
gtggaggaagtgaaggagctgtgtgatggcctggagttagaaaatgaagatgtgtacatg
gcatccacctttggggacttcatccagctgttagtgaggaagctgcgaggggacgatgag
gagggcgagtgcagcattgactacgtggaaatggcagtgaacaagcgcactgtccgcatg
ccccaccagctcttcattgggggggagttcgtggatgccgagggcgccaagacctctgag
accatcaatcccaccgatggaagtgtcatctgccaggtatccctggcccaagtcaccgac
gtcgacaaggcagtggccgcagccaaggatgcctttgagaatggacggtgggggaagatc
agtgcgcgggaccggggccggctgatgtacaggttggcagatctcatggagcagcaccag
gaggagctggccaccattgaggccctggatgcgggtgccgtctacacgctggccctgaag
acccacgtgggcatgtccatccagaccttccgctactttgctggctggtgtgacaagatc
cagggctccaccatccccatcaaccaggccagacccaaccgcaacctgaccttgaccagg
aaggagcctgttggggtttgtggcatcatcatcccctggaactatcccctgatgatgctg
tcctggaagacagctgcctgcctggctgccgggaacacagtggtgatcaagcctgctcag
gtgaccccactcacagccttgaagtttgcagagctgacattaaaggccggcattcccaaa
ggtgtggttaacgtcctcccaggatctggctccctggtcggccagagactctcagaccat
cctgatgtgaggaaaatcgggttcacaggctccacagaggtgggcaagcacatcatgaaa
agctgtgccataagtaacgtgaagaaggtgtccctggaactgggcgggaagtcacccctc
atcatctttgctgactgtgacctcaacaaggctgtgcagatggggatgagttctgttttc
ttcaacaaaggagagaattgcattgcagcaggccgactctttgtggaggactccattcat
gatgagttcgtgcggagagtggtagaagaggtgcggaagatgaaggtgggcaacccgctg
gacagggacaccgaccacgggccgcagaatcaccatgcccaccttgtgaagctgatggag
tactgccagcatggcgtgaaggaaggggccacactggtctgcggcgggaatcaggtccct
cggccagggttcttctttgagccaactgttttcacagacgtggaagaccacatgttcata
gccaaggaggagtccttcgggcctgtcatgatcatctctcggtttgctgatggggacttg
gatgccgtgctgtctcgggccaatgccacggaatttggcctggcttctggtgtcttcacc
agggacatcaacaaggccctgtatgtcagtgacaagctccaggcaggcactgtgtttgtc
aacacgtacaacaagaccgacgtggccgctcccttcggaggattcaaacagtctggattt
ggcaaagatctaggagaggcggctctgaacgagtacctgcgggtcaagacagtgaccttc
gaatactga

KEGG   Homo sapiens (human): 160428
Entry
160428            CDS       T01001                                 

Gene name
ALDH1L2, mtFDH
Definition
(RefSeq) aldehyde dehydrogenase 1 family member L2
  KO
K00289  formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    160428 (ALDH1L2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     160428 (ALDH1L2)
SSDB
Motif
Pfam: Aldedh Formyl_trans_N Formyl_trans_C PP-binding DUF1487
Other DBs
NCBI-GeneID: 160428
NCBI-ProteinID: NP_001029345
OMIM: 613584
HGNC: 26777
Ensembl: ENSG00000136010
Vega: OTTHUMG00000169823
Pharos: Q3SY69(Tbio)
UniProt: Q3SY69 B4DTU7
LinkDB
Position
12q23.3
AA seq 923 aa
MLRRGSQALRRFSTGRVYFKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKLPKWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDIIDSP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPND
TVDALYNRFLFPEGIKAMVEAVQLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQSAE
VLHNWIRGHDKVPGAWTEINGQMVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVL
FGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVP
IIEDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMATKFEGFIQKVVRKLRGED
QEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKTYDTINPTDGSTICKVSYASLA
DVDKAVAAAKDAFENGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSE
HPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAV
FFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLL
QYCETGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDYMYLAKEESFGPIMVISKFQNGD
IDGVLQRANSTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGVKQSG
FGKDLGEEALNEYLKTKTVTLEY
NT seq 2772 nt   +upstreamnt  +downstreamnt
atgctgcggcggggcagccaggcgctccggcgcttctccactggccgggtttatttcaaa
aacaagctgaagttggcactaattggccagagcctctttggacaagaagtctatagccac
ctccgcaaagagggccaccgagtagtaggggtgttcacagttccagacaaggatggaaaa
gctgaccctctggctttggctgcagagaaagatgggacccctgtgttcaagcttcctaaa
tggagggtcaagggcaagaccatcaaagaagtggcagaagcctacagatccgtgggtgca
gagctaaatgtgctccctttctgcactcagttcattcccatggatataattgatagtcca
aagcacggctctatcatttatcacccatccatcctgcccaggcacagaggagcctctgct
atcaattggactctaattatgggagataagaaagctgggttttctgttttctgggctgat
gatggcttggatacaggacccatccttcttcagagatcatgtgatgttgaacccaatgat
acagtggatgcactttataatcggtttctttttcctgaaggaatcaaggccatggtagaa
gctgtccaactcatagctgatggaaaagctcctcgtataccccagccagaagaaggggca
acatatgaaggtatccagaaaaaggaaaatgctgagatttcttgggaccagtctgccgaa
gttttacataactggattcgaggtcatgataaagtccctggagcttggacagagataaat
ggacagatggtcactttctatggctcgacattactgaatagctctgtgcctcctggagaa
ccactggaaattaaaggtgccaagaagcctggtctcgttaccaaaaatggacttgttctt
tttggtaacgatggaaaagcactgacggtgagaaatctgcagtttgaagatggaaaaatg
atccctgcctctcagtacttttcaacgggtgagacgtcagtggtagaactgacagctgaa
gaggtgaaagtggcagagaccatcaaggtcatctgggctggaattttaagcaatgtcccc
attattgaagactcaacagacttctttaaatctggagcaagctcaatggatgttgccagg
ctggttgaagagatcagacagaaatgtggtgggcttcagttgcagaatgaagatgtctat
atggccaccaagtttgaaggctttatccaaaaggtcgtgaggaaactgagaggagaagat
caagaggtggagctggttgtagattatatttcaaaggaggtcaatgaaatcatggtaaaa
atgccataccagtgtttcataaatggacagttcacagatgcagacgatggaaagacttac
gacactatcaacccaacagatggatctacaatatgcaaagtatcctacgcttctttggcg
gatgttgataaagcagtagcagcagcaaaagatgcttttgaaaacggtgaatggggaaga
atgaatgcaagagaaagaggaagattgatgtatagacttgcagacctactggaagagaac
caagaagagctggcaactattgaagcccttgattcaggggctgtctataccttggccctg
aagacacacattggaatgtctgtgcaaacattcagatattttgctggctggtgcgacaaa
attcagggttctactattccaatcaaccaggcccgtccaaatcgcaatctgaccttcacc
aagaaagagccactcggtgtctgtgccattattattccctggaactacccgctgatgatg
ctggcatggaagagtgctgcgtgtttggcagcaggcaataccttagtgctcaagccagca
caggtcacgcccttgactgctttgaagtttgcagaactgtctgtgaaagcaggctttcca
aagggggtcatcaacatcattccaggctcaggtggcatagcaggacaacgtctgtctgaa
catcctgacatccgcaaacttggtttcactggatccactcctattggcaaacagatcatg
aagagctgtgctgttagcaacttgaagaaagtttcccttgagcttggtggcaagtctcca
cttataatatttaatgactgtgaacttgacaaggctgtgcgaatgggcatgggagcagta
tttttcaacaaaggagagaactgtattgctgctgggcggttgttcgtggaagaatccatc
cacgacgaatttgtgacaagagtggtagaagaaattaaaaagatgaaaattggtgatcca
cttgacagatccactgatcatgggccccaaaatcataaggctcatctggaaaagctgctg
caatactgtgaaactggagtgaaagaaggggccactttggtgtacgggggaagacaagtc
caaaggccaggctttttcatggagccgaccgtgttcacagatgtggaagactacatgtac
ctcgccaaagaggaatcctttgggcctattatggtcatttctaaattccaaaatggggac
atcgatggagtgttgcagcgagcaaatagtacagagtatggtttggcctcaggggttttt
acaagagacataaacaaagctatgtatgtgagtgaaaaactggaagcaggaactgttttt
attaacacatacaacaagacagatgtggcggccccatttggcggagttaaacaatctggc
tttggaaaagacttaggtgaggaagctctaaatgaatatctcaaaaccaagacggtgaca
ctggaatattag

DBGET integrated database retrieval system