KEGG   Homo sapiens (human): 10887
Entry
10887             CDS       T01001                                 
Symbol
PROKR1, GPR73, GPR73a, PK-R1, PKR1, ZAQ
Name
(RefSeq) prokineticin receptor 1
  KO
K08379  prokineticin receptor 1
Organism
hsa  Homo sapiens (human)
Network
nt06361  Hypogonadotropic hypogonadism
  Element
N00879  PROK-PRKR-Gi-ERK signaling pathway
N00880  Mutation-inactivated PROK2 to PROK-PRKR-Gi-ERK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    10887 (PROKR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Prokineticin
    10887 (PROKR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 10887
NCBI-ProteinID: NP_620414
OMIM: 607122
HGNC: 4524
Ensembl: ENSG00000169618
Pharos: Q8TCW9(Tchem)
UniProt: Q8TCW9
LinkDB
Position
2:68643579..68658251
AA seq 393 aa
METTMGFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFFA
AKIVIGMALVGIMLVCGIGNFIFIAALVRYKKLRNLTNLLIANLAISDFLVAIVCCPFEM
DYYVVRQLSWEHGHVLCTSVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKCQTAT
GLIALVWTVSILIAIPSAYFTTETVLVIVKSQEKIFCGQIWPVDQQLYYKSYFLFIFGIE
FVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPF
YGFTIVRDFFPTVFVKEKHYLTAFYIVECIAMSNSMINTLCFVTVKNDTVKYFKKIMLLH
WKASYNGGKSSADLDLKTIGMPATEEVDCIRLK
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggagaccaccatggggttcatggatgacaatgccaccaacacttccaccagcttcctt
tctgtgctcaaccctcatggagcccatgccacttccttcccattcaacttcagctacagc
gactatgatatgcctttggatgaagatgaggatgtgaccaattccaggacgttctttgct
gccaagattgtcattgggatggccctggtgggcatcatgctggtctgcggcattggaaac
ttcatctttatcgctgccctggtccgctacaagaaactgcgcaacctcaccaacctgctc
atcgccaacctggccatctctgacttcctggtggccattgtctgctgcccctttgagatg
gactactatgtggtgcgccagctctcctgggagcacggccacgtcctgtgcacctctgtc
aactacctgcgcactgtctctctctatgtctccaccaatgccctgctggccatcgccatt
gacaggtatctggctattgtccatccgctgagaccacggatgaagtgccaaacagccact
ggcctgattgccttggtgtggacggtgtccatcctgatcgccatcccttccgcctacttc
accaccgagacggtcctcgtcattgtcaagagccaggaaaagatcttctgcggccagatc
tggcctgtggaccagcagctctactacaagtcctacttcctctttatctttggcatagaa
ttcgtgggccccgtggtcaccatgaccctgtgctatgccaggatctcccgggagctctgg
ttcaaggcggtccctggattccagacagagcagatccgcaagaggctgcgctgccgcagg
aagacggtcctggtgctcatgtgcatcctcaccgcctacgtgctatgctgggcgcccttc
tacggcttcaccatcgtgcgcgacttcttccccaccgtgtttgtgaaggagaagcactac
ctcactgccttctacatcgtcgagtgcatcgccatgagcaacagcatgatcaacactctg
tgcttcgtgaccgtcaagaacgacaccgtcaagtacttcaaaaagatcatgttgctccac
tggaaggcttcttacaatggcggtaagtccagtgcagacctggacctcaagacaattggg
atgcctgccaccgaagaggtggactgcatcagactaaaataa

KEGG   Homo sapiens (human): 128674
Entry
128674            CDS       T01001                                 
Symbol
PROKR2, GPR73L1, GPR73b, GPRg2, HH3, KAL3, PKR2, dJ680N4.3
Name
(RefSeq) prokineticin receptor 2
  KO
K08380  prokineticin receptor 2
Organism
hsa  Homo sapiens (human)
Network
nt06361  Hypogonadotropic hypogonadism
  Element
N00879  PROK-PRKR-Gi-ERK signaling pathway
N00880  Mutation-inactivated PROK2 to PROK-PRKR-Gi-ERK signaling pathway
N00881  Mutation-inactivated PROKR2 to PROK-PRKR-Gi-ERK signaling pathway
Disease
H00255  Hypogonadotropic hypogonadism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    128674 (PROKR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Prokineticin
    128674 (PROKR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 128674
NCBI-ProteinID: NP_658986
OMIM: 607123
HGNC: 15836
Ensembl: ENSG00000101292
Pharos: Q8NFJ6(Tbio)
UniProt: Q8NFJ6 A8K1T0
LinkDB
Position
20:complement(5299218..5316954)
AA seq 384 aa
MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIAL
AGIMLVCGIGNFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLS
WEHGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMV
SILIAIPSAYFATETVLFIVKSQEKIFCGQIWPVDQQLYYKSYFLFIFGVEFVGPVVTMT
LCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDF
FPTVFVKEKHYLTAFYVVECIAMSNSMINTVCFVTVKNNTMKYFKKMMLLHWRPSQRGSK
SSADLDLRTNGVPTTEEVDCIRLK
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggcagcccagaatggaaacaccagtttcacacccaactttaatccaccccaagaccat
gcctcctccctctcctttaacttcagttatggtgattatgacctccctatggatgaggat
gaggacatgaccaagacccggaccttcttcgcagccaagatcgtcattggcattgcactg
gcaggcatcatgctggtctgcggcatcggtaactttgtctttatcgctgccctcacccgc
tataagaagttgcgcaacctcaccaatctgctcattgccaacctggccatctccgacttc
ctggtggccatcatctgctgccccttcgagatggactactacgtggtacggcagctctcc
tgggagcatggccacgtgctctgtgcctccgtcaactacctgcgcaccgtctccctctac
gtctccaccaatgccttgctggccattgccattgacagatatctcgccatcgttcacccc
ttgaaaccacggatgaattatcaaacggcctccttcctgatcgccttggtctggatggtg
tccattctcattgccatcccatcggcttactttgcaacagaaacggtcctctttattgtc
aagagccaggagaagatcttctgtggccagatctggcctgtggatcagcagctctactac
aagtcctacttcctcttcatctttggtgtcgagttcgtgggccctgtggtcaccatgacc
ctgtgctatgccaggatctcccgggagctctggttcaaggcagtccctgggttccagacg
gagcagattcgcaagcggctgcgctgccgcaggaagacggtcctggtgctcatgtgcatt
ctcacggcctatgtgctgtgctgggcacccttctacggtttcaccatcgttcgtgacttc
ttccccactgtgttcgtgaaggaaaagcactacctcactgccttctacgtggtcgagtgc
atcgccatgagcaacagcatgatcaacaccgtgtgcttcgtgacggtcaagaacaacacc
atgaagtacttcaagaagatgatgctgctgcactggcgtccctcccagcgggggagcaag
tccagtgctgaccttgacctcagaaccaacggggtgcccaccacagaagaggtggactgt
atcaggctgaagtga

DBGET integrated database retrieval system