Homo sapiens (human): 10890 Help Entry 10890             CDS       T01001                                  Symbol RAB10 Name (RefSeq) RAB10, member RAS oncogene family   KO K07903   Ras-related protein Rab-10 Organism hsa  Homo sapiens (human) Pathway hsa04144   Endocytosis hsa04152   AMPK signaling pathway Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     10890 (RAB10)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     10890 (RAB10)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     10890 (RAB10)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     10890 (RAB10)    04031 GTP-binding proteins [BR:hsa04031]     10890 (RAB10) Membrane trafficking [BR:hsa04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     10890 (RAB10)  Protein recycling   Rab GTPases and associated proteins     10890 (RAB10) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    10890 (RAB10)   Exosomal proteins of other body fluids (saliva and urine)    10890 (RAB10)   Exosomal proteins of colorectal cancer cells    10890 (RAB10)   Exosomal proteins of bladder cancer cells    10890 (RAB10) GTP-binding proteins [BR:hsa04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     10890 (RAB10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB MMR_HSR1 AAA_7 TniB DUF3963 Motif Other DBs NCBI-GeneID:  10890 NCBI-ProteinID:  NP_057215 OMIM:  612672 HGNC:  9759 Ensembl:  ENSG00000084733 Vega:  OTTHUMG00000094796 Pharos:  P61026(Tbio) UniProt:  P61026 LinkDB All DBs Structure PDB:  5SZJ 5LPN Thumbnails Position 2p23.3 AA seq 200 aa AA seqDB search MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKL QIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLL GNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPN SENVDISSGGGVTGWKSKCC NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atggcgaagaagacgtacgacctgcttttcaagctgctcctgatcggggattccggagtg gggaagacctgcgtcctttttcgtttttcggatgatgccttcaatactacctttatttcc accataggaatagacttcaagatcaaaacagttgaattacaaggaaagaagatcaagcta cagatatgggatacagcaggccaggagcgatttcacaccatcacaacctcctactacaga ggcgcaatgggtatcatgctagtatatgacatcaccaatggtaaaagttttgaaaacatc agcaaatggcttagaaacatagatgagcatgccaatgaagatgtggaaagaatgttacta ggaaacaagtgtgatatggacgacaaaagagttgtacctaaaggaaaaggagaacagatt gcaagggagcatggtattaggttttttgagactagtgcaaaagcaaatataaacatcgaa aaggcgttcctcacgttagctgaagatatccttcgaaagacccctgtaaaagagcccaac agtgaaaatgtagatatcagcagtggaggaggcgtgacaggctggaagagcaaatgctgc tga

Homo sapiens (human): 4218 Help Entry 4218              CDS       T01001                                  Symbol RAB8A, MEL, RAB8 Name (RefSeq) RAB8A, member RAS oncogene family   KO K07901   Ras-related protein Rab-8A Organism hsa  Homo sapiens (human) Pathway hsa04140   Autophagy - animal hsa04144   Endocytosis hsa04152   AMPK signaling pathway hsa04530   Tight junction hsa04972   Pancreatic secretion hsa05014   Amyotrophic lateral sclerosis hsa05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     4218 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     4218 (RAB8A)    04140 Autophagy - animal     4218 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     4218 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     4218 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     4218 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     4218 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     4218 (RAB8A)    03036 Chromosome and associated proteins [BR:hsa03036]     4218 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     4218 (RAB8A)    04031 GTP-binding proteins [BR:hsa04031]     4218 (RAB8A) Membrane trafficking [BR:hsa04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     4218 (RAB8A)  Autophagy   Other autophagy associated proteins     4218 (RAB8A) Chromosome and associated proteins [BR:hsa03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Other centriole associated proteins     4218 (RAB8A) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    4218 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    4218 (RAB8A)   Exosomal proteins of colorectal cancer cells    4218 (RAB8A) GTP-binding proteins [BR:hsa04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     4218 (RAB8A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA SRPRB MMR_HSR1 GTP_EFTU Septin DUF3963 AAA_7 Phage_holin_6_1 AAA_16 Motif Other DBs NCBI-GeneID:  4218 NCBI-ProteinID:  NP_005361 OMIM:  165040 HGNC:  7007 Ensembl:  ENSG00000167461 Vega:  OTTHUMG00000182238 Pharos:  P61006(Tbio) UniProt:  P61006 A0A024R7I3 LinkDB All DBs Structure PDB:  4LHW 4LHV 3QBT 3TNF 5SZI 4LHX 4LHY 4LHZ 4LI0 Thumbnails Position 19p13.11 AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccacttttatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaaactgcag atatgggacacagccggtcaggaacggtttcggacgatcacaacggcctactacaggggt gcaatgggcatcatgctggtctacgacatcaccaacgagaagtccttcgacaacatccgg aactggattcgcaacattgaggagcacgcctctgcagacgtcgaaaagatgatactcggg aacaagtgtgatgtgaatgacaagagacaagtttccaaggaacggggagaaaagctggcc ctcgactatggaatcaagttcatggagaccagcgcgaaggccaacatcaatgtggaaaat gcatttttcactctcgccagagatatcaaagcaaaaatggacaaaaaattggaaggcaac agcccccaggggagcaaccagggagtcaaaatcacaccggaccagcagaagaggagcagc tttttccgatgtgttcttctgtga

Homo sapiens (human): 51552 Help Entry 51552             CDS       T01001                                  Symbol RAB14, FBP, RAB-14 Name (RefSeq) RAB14, member RAS oncogene family   KO K07881   Ras-related protein Rab-14 Organism hsa  Homo sapiens (human) Pathway hsa04152   AMPK signaling pathway Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     51552 (RAB14)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     51552 (RAB14)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     51552 (RAB14)    04031 GTP-binding proteins [BR:hsa04031]     51552 (RAB14) Membrane trafficking [BR:hsa04131]  Protein recycling   Rab GTPases and associated proteins    Rab GTPases     51552 (RAB14) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    51552 (RAB14)   Exosomal proteins of other body fluids (saliva and urine)    51552 (RAB14)   Exosomal proteins of colorectal cancer cells    51552 (RAB14) GTP-binding proteins [BR:hsa04031]  Small (monomeric) G-proteins   Rab Family    Rab2/4/14 [OT]     51552 (RAB14) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 Gtr1_RagA SRPRB DUF1863 Septin AAA AAA_22 Motif Other DBs NCBI-GeneID:  51552 NCBI-ProteinID:  NP_057406 OMIM:  612673 HGNC:  16524 Ensembl:  ENSG00000119396 Vega:  OTTHUMG00000020582 Pharos:  P61106(Tbio) UniProt:  P61106 A0A024R845 LinkDB All DBs Structure PDB:  1Z0F 4DRZ 4D0G Thumbnails Position 9q33.2 AA seq 215 aa AA seqDB search MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKI KLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVII LIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGS LDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggcaactgcaccatacaactactcttacatctttaaatatattattattggggacatg ggagtaggaaaatcttgcttgcttcatcaatttacagaaaaaaaatttatggctgattgt cctcacacaattggtgttgaatttggtacaagaataatcgaagttagtggccaaaaaata aaactgcagatttgggatacggcaggacaggagcgatttagggctgttacacggagctac tacagaggagctgcgggagctcttatggtctatgatatcactagaagaagtacatataac cacttaagcagctggttgacagatgcaaggaatctcaccaatccaaatactgtaataatt ctcataggaaataaagcagatttggaggcacagagagatgttacatatgaagaagccaaa cagtttgctgaagaaaatggcttattgttcctcgaagcgagtgcaaaaacgggagagaat gtagaagatgccttccttgaggctgccaagaaaatctatcagaacattcaggatggaagc ttggatctgaatgctgctgagtctggtgtacaacacaaaccttcagccccgcagggaggc cggctaaccagtgaaccccaaccccagagagaaggctgtggctgctag

Homo sapiens (human): 5862 Help Entry 5862              CDS       T01001                                  Symbol RAB2A, LHX, RAB2 Name (RefSeq) RAB2A, member RAS oncogene family   KO K07877   Ras-related protein Rab-2A Organism hsa  Homo sapiens (human) Pathway hsa04152   AMPK signaling pathway Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     5862 (RAB2A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     5862 (RAB2A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     5862 (RAB2A)    04031 GTP-binding proteins [BR:hsa04031]     5862 (RAB2A) Membrane trafficking [BR:hsa04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab GTPases     5862 (RAB2A) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    5862 (RAB2A)   Exosomal proteins of other body fluids (saliva and urine)    5862 (RAB2A)   Exosomal proteins of colorectal cancer cells    5862 (RAB2A) GTP-binding proteins [BR:hsa04031]  Small (monomeric) G-proteins   Rab Family    Rab2/4/14 [OT]     5862 (RAB2A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_22 DAP3 Motif Other DBs NCBI-GeneID:  5862 NCBI-ProteinID:  NP_002856 OMIM:  179509 HGNC:  9763 Ensembl:  ENSG00000104388 Vega:  OTTHUMG00000134298 Pharos:  P61019(Tbio) UniProt:  P61019 A0A024R7V6 LinkDB All DBs Structure PDB:  1Z0A Thumbnails Position 8q12.1-q12.2 AA seq 212 aa AA seqDB search MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIW DTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNK SDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINN EANGIKIGPQHAATNATHAGNQGGQQAGGGCC NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atggcgtacgcctatctcttcaagtacatcataatcggcgacacaggtgttggtaaatca tgcttattgctacagtttacagacaagaggtttcagccagtgcatgaccttactattggt gtagagttcggtgctcgaatgataactattgatgggaaacagataaaacttcagatatgg gatacggcagggcaagaatcctttcgttccatcacaaggtcgtattacagaggtgcagca ggagctttactagtttacgatattacacggagagatacattcaaccacttgacaacctgg ttagaagatgcccgccagcattccaattccaacatggtcattatgcttattggaaataaa agtgatttagaatctagaagagaagtaaaaaaagaagaaggtgaagcttttgcacgagaa catggactcatcttcatggaaacgtctgctaagactgcttccaatgtagaagaggcattt attaatacagcaaaagaaatttatgaaaaaattcaagaaggagtctttgacattaataat gaggcaaatggcattaaaattggccctcagcatgctgctaccaatgcaacacatgcaggc aatcagggaggacagcaggctgggggcggctgctgttga

Homo sapiens (human): 9230 Help Entry 9230              CDS       T01001                                  Symbol RAB11B, H-YPT3, NDAGSCW Name (RefSeq) RAB11B, member RAS oncogene family   KO K07905   Ras-related protein Rab-11B Organism hsa  Homo sapiens (human) Pathway hsa04144   Endocytosis hsa04152   AMPK signaling pathway hsa04962   Vasopressin-regulated water reabsorption hsa05164   Influenza A Disease H02470   Neurodevelopmental disorder with structural brain abnormalities Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     9230 (RAB11B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     9230 (RAB11B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     9230 (RAB11B)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     9230 (RAB11B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     9230 (RAB11B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     9230 (RAB11B)    04031 GTP-binding proteins [BR:hsa04031]     9230 (RAB11B) Membrane trafficking [BR:hsa04131]  Protein recycling   Rab GTPases and associated proteins    Rab GTPases     9230 (RAB11B) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    9230 (RAB11B)   Exosomal proteins of other body fluids (saliva and urine)    9230 (RAB11B)   Exosomal proteins of colorectal cancer cells    9230 (RAB11B) GTP-binding proteins [BR:hsa04031]  Small (monomeric) G-proteins   Rab Family    Rab11/25 [OT]     9230 (RAB11B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 PduV-EutP FeoB_N ABC_tran Gtr1_RagA NTPase_1 SRPRB TniB AAA_14 FAD-SLDH AAA_24 Ploopntkinase3 AAA_5 AAA_21 Motif Other DBs NCBI-GeneID:  9230 NCBI-ProteinID:  NP_004209 OMIM:  604198 HGNC:  9761 Ensembl:  ENSG00000185236 Vega:  OTTHUMG00000182278 Pharos:  Q15907(Tbio) UniProt:  Q15907 LinkDB All DBs Structure PDB:  2F9L 2F9M 4OJK Thumbnails Position 19p13.2 AA seq 218 aa AA seqDB search MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atggggacccgggacgacgagtacgactacctattcaaagtggtgctcatcggggactca ggcgtgggcaagagcaacctgctgtcgcgcttcacccgcaacgagttcaacctggagagc aagagcaccatcggcgtggagttcgccacccgcagcatccaggtggacggcaagaccatc aaggcgcagatctgggacaccgctggccaggagcgctaccgcgccatcacctccgcgtac taccgtggtgcagtgggcgccctgctggtgtacgacatcgccaagcacctgacctatgag aacgtggagcgctggctgaaggagctgcgggaccacgcagacagcaacatcgtcatcatg ctggtgggcaacaagagtgacctgcgccacctgcgggctgtgcccactgacgaggcccgc gccttcgcagaaaagaacaacttgtccttcatcgagacctcagccttggattccactaac gtagaggaagcattcaagaacatcctcacagagatctaccgcatcgtgtcacagaaacag atcgcagaccgcgctgcccacgacgagtccccggggaacaacgtggtggacatcagcgtg ccgcccaccacggacggacagaagcccaacaagctgcagtgctgccagaacctgtga

DBGET integrated database retrieval system