KEGG   Homo sapiens (human): 10911
Entry
10911             CDS       T01001                                 
Symbol
UTS2, PRO1068, U-II, UCN2, UII
Name
(RefSeq) urotensin 2
  KO
K05248  urotensin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10911 (UTS2)
SSDB
Motif
Pfam: Urotensin_II
Other DBs
NCBI-GeneID: 10911
NCBI-ProteinID: NP_006777
OMIM: 604097
HGNC: 12636
Ensembl: ENSG00000049247
Pharos: O95399(Tchem)
CPD: C16016
UniProt: O95399
Structure
LinkDB
Position
1:complement(7847612..7913249)
AA seq 124 aa
MYKLASCCLLFIGFLNPLLSLPLLDSREISFQLSAPHEDARLTPEELERASLLQILPEML
GAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFW
KYCV
NT seq 375 nt   +upstreamnt  +downstreamnt
atgtataagctggcctcctgctgtttgcttttcataggattcttaaatcctctcttatct
cttcctctccttgactccagggaaatatcctttcaactctcagcacctcatgaagacgcg
cgcttaactccggaggagctagaaagagcttcccttctacagatactgccagagatgctg
ggtgcagaaagaggggatattctcaggaaagcagactcaagtaccaacatttttaaccca
agaggaaatttgagaaagtttcaggatttctctggacaagatcctaacattttactgagt
catcttttggccagaatctggaaaccatacaagaaacgtgagactcctgattgcttctgg
aaatactgtgtctga

KEGG   Homo sapiens (human): 257313
Entry
257313            CDS       T01001                                 
Symbol
UTS2B, U-IIB, U2B, UIIB, URP, UTS2D
Name
(RefSeq) urotensin 2B
  KO
K24267  urotensin-2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    257313 (UTS2B)
SSDB
Motif
Pfam: Urotensin_II
Other DBs
NCBI-GeneID: 257313
NCBI-ProteinID: NP_937795
OMIM: 618134
HGNC: 30894
Ensembl: ENSG00000188958
Pharos: Q765I0(Tbio)
UniProt: Q765I0
LinkDB
Position
3:complement(191267168..191346182)
AA seq 119 aa
MNKILSSTVCFGLLTLLSVLSFLQSVHGRPYLTQGNEIFPDKKYTNREELLLALLNKNFD
FQRPFNTDLALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV
NT seq 360 nt   +upstreamnt  +downstreamnt
atgaacaagatcctctcaagcactgtttgctttggactcctaactttgttatccgtgttg
agttttttacaatctgtgcatggacgaccatatcttacccaaggaaatgaaatatttcca
gataaaaaatatacaaatcgtgaggaactattgctggctctactgaataaaaattttgat
ttccaaagacctttcaacactgacctagccttacctaacaaactggaagaacttaaccag
ctggaaaagctaaaagaacagctagtggaggagaaggattctgagacgtcctatgctgta
gatggtctattctcttctcatcctagcaaacgagcttgcttttggaaatactgtgtttaa

DBGET integrated database retrieval system