KEGG   Homo sapiens (human): 10926
Entry
10926             CDS       T01001                                 
Symbol
DBF4, ASK, CHIF, DBF4A, ZDBF1
Name
(RefSeq) DBF4 zinc finger
  KO
K06629  protein DBF4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Network
nt06509  DNA replication
  Element
N01468  DNA replication licensing
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    10926 (DBF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    10926 (DBF4)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   DDK (Dbf-4 dependent kinase)
    10926 (DBF4)
SSDB
Motif
Pfam: zf-DBF BRCT PTCB-BRCT BRCT_2
Other DBs
NCBI-GeneID: 10926
NCBI-ProteinID: NP_006707
OMIM: 604281
HGNC: 17364
Ensembl: ENSG00000006634
Pharos: Q9UBU7(Tbio)
UniProt: Q9UBU7
Structure
LinkDB
Position
7:87876493..87909553
AA seq 674 aa
MNSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTI
SEKLQKDIKDLGGRVEEFLSKDISYLISNKKEAKFAQTLGRISPVPSPESAYTAETTSPH
PSHDGSSFKSPDTVCLSRGKLLVEKAIKDHDFIPSNSILSNALSWGVKILHIDDIRYYIE
QKKKELYLLKKSSTSVRDGGKRVGSGAQKTRTGRLKKPFVKVEDMSQLYRPFYLQLTNMP
FINYSIQKPCSPFDVDKPSSMQKQTQVKLRIQTDGDKYGGTSIQLQLKEKKKKGYCECCL
QKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYEKDTPKKKRIKYSVGSLSP
VSASVLKKTEQKEKVELQHISQKDCQEDDTTVKEQNFLYKETQETEKKLLFISEPIPHPS
NELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVD
HYKCNIQASVHVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQ
EHLTVQAKAPFHTPPEEPNECDFKNMDSLPSGKIHRKVKIILGRNRKENLEPNAEFDKRT
EFITQEENRICSSPVQSLLDLFQTSEEKSEFLGFTSYTEKSGICNVLDIWEEENSDNLLT
AFFSSPSTSTFTGF
NT seq 2025 nt   +upstreamnt  +downstreamnt
atgaactccggagccatgaggatccacagtaaaggacatttccagggtggaatccaagtc
aaaaatgaaaaaaacagaccatctctgaaatctctgaaaactgataacaggccagaaaaa
tccaaatgtaagccactttggggaaaagtattttaccttgacttaccttctgtcaccata
tctgaaaaacttcaaaaggacattaaggatctgggagggcgagttgaagaatttctcagc
aaagatatcagttatcttatttcaaataagaaggaagctaaatttgcacaaaccttgggt
cgaatttctcctgtaccaagtccagaatctgcatatactgcagaaaccacttcacctcat
cccagccatgatggaagttcatttaagtcaccagacacagtgtgtttaagcagaggaaaa
ttattagttgaaaaagctatcaaggaccatgattttattccttcaaatagtatattatca
aatgccttgtcatggggagtaaaaattcttcatattgatgacattagatactacattgaa
caaaagaaaaaagagttgtatttactcaagaaatcaagtacttcagtaagagatgggggc
aaaagagttggtagtggtgcacaaaaaacaagaacaggaagactcaaaaagccttttgta
aaggtggaagatatgagccaactttataggccattttatcttcagctgaccaatatgcct
tttataaattattctattcagaagccctgcagtccatttgatgtagacaagccatctagt
atgcaaaagcaaactcaggttaaactaagaatccaaacagatggcgataagtatggtgga
acctcaattcaactccagttgaaagagaagaagaaaaaaggatattgtgaatgttgcttg
cagaaatatgaagatctagaaactcaccttctaagtgagcaacacagaaactttgcacag
agtaaccagtatcaagttgttgatgatattgtatctaagttagtttttgactttgtggaa
tatgaaaaggacacacctaaaaagaaaagaataaaatacagtgttggatccctttctcct
gtttctgcaagtgtcctgaaaaagactgaacaaaaggaaaaagtggaattgcaacatatt
tctcagaaagattgccaggaagatgatacaacagtgaaggagcagaatttcctgtataaa
gagacccaggaaactgaaaaaaagctcctgtttatttcagagcccatcccccacccttca
aatgaattgagagggcttaatgagaaaatgagtaataaatgttccatgttaagtacagct
gaagatgacataagacagaattttacacagctacctctacataaaaacaaacaggaatgc
attcttgacatttccgaacacacattaagtgaaaatgacttagaagaactaagggtagat
cactataaatgtaacatacaggcatctgtacatgtttctgatttcagtacagataatagt
ggatctcaaccaaaacagaagtcagatactgtgctttttccagcaaaggatctcaaggaa
aaggaccttcattcaatatttactcatgattctggtctgataacaataaacagttcacaa
gagcacctaactgttcaggcaaaggctccattccatactcctcctgaggaacccaatgaa
tgtgacttcaagaatatggatagtttaccttctggtaaaatacatcgaaaagtgaaaata
atattaggacgaaatagaaaagaaaatctggaaccaaatgctgaatttgataaaagaact
gaatttattacacaagaagaaaacagaatttgtagttcaccggtacagtctttactagac
ttgtttcagactagtgaagagaaatcagaatttttgggtttcacaagctacacagaaaag
agtggtatatgcaatgttttagatatttgggaagaggaaaattcagataatctgttaaca
gcgtttttctcgtccccttcaacttctacatttactggcttttag

DBGET integrated database retrieval system