KEGG   Homo sapiens (human): 11065
Entry
11065             CDS       T01001                                 
Symbol
UBE2C, UBCH10, dJ447F3.2
Name
(RefSeq) ubiquitin conjugating enzyme E2 C
  KO
K06688  ubiquitin-conjugating enzyme E2 C [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    11065 (UBE2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    11065 (UBE2C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     11065 (UBE2C)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   11065 (UBE2C)
SSDB
Motif
Pfam: UQ_con UEV RWD
Other DBs
NCBI-GeneID: 11065
NCBI-ProteinID: NP_008950
OMIM: 605574
HGNC: 15937
Ensembl: ENSG00000175063
Pharos: O00762(Tbio)
UniProt: O00762 Q5TZN3
Structure
LinkDB
Position
20:45812644..45816952
AA seq 179 aa
MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLF
KWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKE
KWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcttcccaaaaccgcgacccagccgccactagcgtcgccgccgcccgtaaaggagct
gagccgagcgggggcgccgcccggggtccggtgggcaaaaggctacagcaggagctgatg
accctcatgatgtctggcgataaagggatttctgccttccctgaatcagacaaccttttc
aaatgggtagggaccatccatggagcagctggaacagtatatgaagacctgaggtataag
ctctcgctagagttccccagtggctacccttacaatgcgcccacagtgaagttcctcacg
ccctgctatcaccccaacgtggacacccagggtaacatatgcctggacatcctgaaggaa
aagtggtctgccctgtatgatgtcaggaccattctgctctccatccagagccttctagga
gaacccaacattgatagtcccttgaacacacatgctgccgagctctggaaaaaccccaca
gcttttaagaagtacctgcaagaaacctactcaaagcaggtcaccagccaggagccctga

DBGET integrated database retrieval system