KEGG   Homo sapiens (human): 1108
Entry
1108              CDS       T01001                                 
Symbol
CHD4, CHD-4, Mi-2b, Mi2-BETA, SIHIWES
Name
(RefSeq) chromodomain helicase DNA binding protein 4
  KO
K11643  chromodomain-helicase-DNA-binding protein 4 [EC:5.6.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
Network
nt06123  TNF signaling (viruses and bacteria)
nt06166  Human papillomavirus (HPV)
  Element
N00375  HPV E7 to TNF-IRF1 signaling pathway
Disease
H02328  Sifrim-Hitz-Weiss syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    1108 (CHD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    1108 (CHD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1108 (CHD4)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     1108 (CHD4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    1108 (CHD4)
  Chromatin remodeling factors
   NuRD complex
    1108 (CHD4)
SSDB
Motif
Pfam: CHDCT2 CHDII_SANT-like SNF2-rel_dom DUF1087 CHDNT Helicase_C PHD Chromo ResIII HDA2-3 zf-HC5HC2H PHD_2 HMG_box DEAD zf-PHD-like
Other DBs
NCBI-GeneID: 1108
NCBI-ProteinID: NP_001264
OMIM: 603277
HGNC: 1919
Ensembl: ENSG00000111642
Vega: OTTHUMG00000169164
Pharos: Q14839(Tbio)
UniProt: Q14839
Structure
LinkDB
Position
12:complement(6570082..6607379)
AA seq 1912 aa
MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKP
RDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKL
GPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKA
FSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVESM
VTATEVAPPPPPVEVPIRKAKTKEGKGPNARRKPKGSPRVPDAKKPKPKKVAPLKIKLGG
FGSKRKRSSSEDDDLDVESDFDDASINSYSVSDGSTSRSSRSRKKLRTTKKKKKGEEEVT
AVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQ
WEAKEDNSEGEEILEEVGGDLEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPL
PEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPE
RQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKN
KDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVE
IQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYLD
ATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLV
SAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKE
ASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLL
TGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKA
DVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCN
HPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLD
LLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADT
VIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVR
PGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDR
NQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVDPDYWEKLLRH
HYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDYSVASEEGDEDFDER
SEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFT
TQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMS
LIRKKVQEFEHVNGRWSMPELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPA
EDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVEPPEGEEKVEK
AEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETP
KDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAG
IINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLR
RAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEEL
LSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLANRAPEPTPQQVAQQQ
NT seq 5739 nt   +upstreamnt  +downstreamnt
atggcgtcgggcctgggctccccgtccccctgctcggcgggcagtgaggaggaggatatg
gatgcacttttgaacaacagcctgcccccaccccacccagaaaatgaagaggacccagaa
gaggatttgtcagaaacagagactccaaagctcaagaagaagaaaaagcctaagaaacct
cgggaccctaaaatccctaagagcaagcgccaaaaaaaggagcgtatgctcttatgccgg
cagctgggggacagctctggggaggggccagagtttgtggaggaggaggaagaggtggct
ctgcgctcagacagtgagggcagcgactatactcctggcaagaagaagaagaagaagctt
ggacctaagaaagagaagaagagcaaatccaagcggaaggaggaggaggaggaggaggat
gatgatgatgattcaaaggagcctaaatcatctgctcagctcctggaagactggggcatg
gaagacattgaccacgtgttctcagaggaggattatcgaaccctcaccaactacaaggcc
ttcagccagtttgtcagacccctcattgctgccaaaaatcccaagattgctgtctccaag
atgatgatggttttgggtgcaaaatggcgggagttcagtaccaataaccccttcaaaggc
agttctggggcatcagtggcagctgcggcagcagcagcggtagctgtggtggagagcatg
gtgacagccactgaggttgcaccaccacctccccctgtggaggtgcctatccgcaaggcc
aagaccaaggagggcaaaggtcccaatgctcggaggaagcccaagggcagccctcgtgta
cctgatgccaagaagcctaaacccaagaaagtagctcccctgaaaatcaagctgggaggt
tttggttccaagcgtaagagatcctcgagtgaggatgatgacttagatgtggaatctgac
ttcgatgatgccagtatcaatagctattctgtttctgatggttccaccagccgtagtagc
cgcagccgcaagaaactccgaaccactaaaaagaaaaagaaaggcgaggaggaggtgact
gctgtggatggttatgagacagaccaccaggactattgcgaggtgtgccagcaaggcggt
gagatcatcctgtgtgatacctgtccccgtgcttaccacatggtctgcctggatcccgac
atggagaaggctcccgagggcaagtggagctgcccacactgcgagaaggaaggcatccag
tgggaagctaaagaggacaattcggagggtgaggagatcctggaagaggttgggggagac
ctcgaagaggaggatgaccaccatatggaattctgtcgggtctgcaaggatggtggggaa
ctgctctgctgtgatacctgtccttcttcctaccacatccactgcctgaatcccccactt
ccagagatccccaacggtgaatggctctgtccccgttgtacgtgtccagctctgaagggc
aaagtgcagaagatcctaatctggaagtggggtcagccaccatctcccacaccagtgcct
cggcctccagatgctgatcccaacacgccctccccaaagcccttggaggggcggccagag
cggcagttctttgtgaaatggcaaggcatgtcttactggcactgctcctgggtttctgaa
ctgcagctggagctgcactgtcaggtgatgttccgaaactatcagcggaagaatgatatg
gatgagccaccttctggggactttggtggtgatgaagagaaaagccgaaagcgaaagaac
aaggaccctaaatttgcagagatggaggaacgcttctatcgctatgggataaaacccgag
tggatgatgatccaccgaatcctcaaccacagtgtggacaagaagggccacgtccactac
ttgatcaagtggcgggacttaccttacgatcaggcttcttgggagagtgaggatgtggag
atccaggattacgacctgttcaagcagagctattggaatcacagggagttaatgaggggt
gaggaaggccgaccaggcaagaagctcaagaaggtgaagcttcggaagttggagaggcct
ccagaaacgccaacagttgatccaacagtgaagtatgagcgacagccagagtacctggat
gctacaggtggaaccctgcacccctatcaaatggagggcctgaattggttgcgcttctcc
tgggctcagggcactgacaccatcttggctgatgagatgggccttgggaaaactgtacag
acagcagtcttcctgtattccctttacaaggagggtcattccaaaggccccttcctagtg
agcgcccctctttctaccatcatcaactgggagcgggagtttgaaatgtgggctccagac
atgtatgtcgtaacctatgtgggtgacaaggacagccgtgccatcatccgagagaatgag
ttctcctttgaagacaatgccattcgtggtggcaagaaggcctcccgcatgaagaaagag
gcatctgtgaaattccatgtgctgctgacatcctatgaattgatcaccattgacatggct
attttgggctctattgattgggcctgcctcatcgtggatgaagcccatcggctgaagaac
aatcagtctaagttcttccgggtattgaatggttactcactccagcacaagctgttgctg
actgggacaccattacaaaacaatctggaagagttgtttcatctgctcaactttctcacc
cccgagaggttccacaatttggaaggttttttggaggagtttgctgacattgccaaggag
gaccagataaaaaaactgcatgacatgctggggccgcacatgttgcggcggctcaaagcc
gatgtgttcaagaacatgccctccaagacagaactaattgtgcgtgtggagctgagccct
atgcagaagaaatactacaagtacatcctcactcgaaattttgaagcactcaatgcccga
ggtggtggcaaccaggtgtctctgctgaatgtggtgatggatcttaagaagtgctgcaac
catccatacctcttccctgtggctgcaatggaagctcctaagatgcctaatggcatgtat
gatggcagtgccctaatcagagcatctgggaaattattgctgctgcagaaaatgctcaag
aaccttaaggagggtgggcatcgtgtactcatcttttcccagatgaccaagatgctagac
ctgctagaggatttcttggaacatgaaggttataaatacgaacgcatcgatggtggaatc
actgggaacatgcggcaagaggccattgaccgcttcaatgcaccgggtgctcagcagttc
tgcttcttgctttccactcgagctgggggccttggaatcaatctggccactgctgacaca
gttattatctatgactctgactggaacccccataatgacattcaggcctttagcagagct
caccggattgggcaaaataaaaaggtaatgatctaccggtttgtgacccgtgcgtcagtg
gaggagcgcatcacgcaggtggcaaagaagaaaatgatgctgacgcatctagtggtgcgg
cctgggctgggctccaagactggatctatgtccaaacaggagcttgatgatatcctcaaa
tttggcactgaggaactattcaaggatgaagccactgatggaggaggagacaacaaagag
ggagaagatagcagtgttatccactacgatgataaggccattgaacggctgctagaccgt
aaccaggatgagactgaagacacagaattgcagggcatgaatgaatatttgagctcattc
aaagtggcccagtatgtggtacgggaagaagaaatgggggaggaagaggaggtagaacgg
gaaatcattaaacaggaagaaagtgtggatcctgactactgggagaaattgctgcggcac
cattatgagcagcagcaagaagatctagcccgaaatctgggcaaaggaaaaagaatccgt
aaacaggtcaactacaatgatggctcccaggaggaccgagattggcaggacgaccagtcc
gacaaccagtccgattactcagtggcttcagaggaaggtgatgaagactttgatgaacgt
tcagaagctccccgtaggcccagtcgtaagggcctgcggaatgataaagataagccattg
cctcctctgttggcccgtgttggtgggaatattgaagtacttggttttaatgctcgtcag
cgaaaagcctttcttaatgcaattatgcgatatggtatgccacctcaggatgcttttact
acccagtggcttgtaagagacctgcgaggcaaatcagagaaagagttcaaggcatatgtc
tctcttttcatgcggcatttatgtgagccgggggcagatggggctgagacctttgctgat
ggtgtcccccgagaaggcctgtctcgccagcatgtccttactagaattggtgttatgtct
ttgattcgcaagaaggttcaggagtttgaacatgttaatgggcgctggagcatgcctgaa
ctggctgaggtggaggaaaacaagaagatgtcccagccagggtcaccctccccaaaaact
cctacaccctccactccaggggacacgcagcccaacactcctgcacctgtcccacctgct
gaagatgggataaaaatagaggaaaatagcctcaaagaagaagagagcatagaaggagaa
aaggaggttaaatctacagcccctgagactgccattgagtgtacacaggcccctgcccct
gcctcagaggatgaaaaggtcgttgttgaaccccctgagggagaggagaaagtggaaaag
gcagaggtgaaggagagaacagaggaacctatggagacagagcccaaaggtgctgctgat
gtagagaaggtggaggaaaagtcagcaatagatctgacccctattgtggtagaagacaaa
gaagagaagaaagaagaagaagagaaaaaagaggtgatgcttcagaatggagagaccccc
aaggacctgaatgatgagaaacagaagaaaaatattaaacaacgtttcatgtttaacatt
gcagatggtggttttactgagttgcactccctttggcagaatgaagagcgggcagccaca
gttaccaagaagacttatgagatctggcatcgacggcatgactactggctgctagccggc
attataaaccatggctatgcccggtggcaagacatccagaatgacccacgctatgccatc
ctcaatgagcctttcaagggtgaaatgaaccgtggcaatttcttagagatcaagaataaa
tttctagctcgaaggtttaagctcttagaacaagctctggtgattgaggaacagctgcgc
cgggctgcttacttgaacatgtcagaagacccttctcacccttccatggccctcaacacc
cgctttgctgaggtggagtgtttggcggaaagtcatcagcacctgtccaaggagtcaatg
gcaggaaacaagccagccaatgcagtcctgcacaaagttctgaaacagctggaagaactg
ctgagtgacatgaaagctgatgtgactcgactcccagctaccattgcccgaattccccca
gttgctgtgaggttacagatgtcagagcgtaacattctcagccgcctggcaaaccgggca
cccgaacctaccccacagcaggtagcccagcagcagtga

DBGET integrated database retrieval system