KEGG   Homo sapiens (human): 11100
Entry
11100             CDS       T01001                                 
Symbol
HNRNPUL1, E1B-AP5, E1BAP5, HNRPUL1
Name
(RefSeq) heterogeneous nuclear ribonucleoprotein U like 1
  KO
K15047  heterogeneous nuclear ribonucleoprotein U-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05164  Influenza A
Network
nt06170  Influenza A virus (IAV)
  Element
N00746  IAV NS1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    11100 (HNRNPUL1)
SSDB
Motif
Pfam: AAA_33 SPRY SAP SAP_new25 AAA_18 SRP54
Other DBs
NCBI-GeneID: 11100
NCBI-ProteinID: NP_008971
OMIM: 605800
HGNC: 17011
Ensembl: ENSG00000105323
Vega: OTTHUMG00000182740
Pharos: Q9BUJ2(Tbio)
UniProt: Q9BUJ2
LinkDB
Position
19:41262557..41307787
AA seq 856 aa
MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALEAEEPDDERELDADDEPGRPGHI
NEEVETEGGSELEGTAQPPPPGLQPHAEPGGYSGPDGHYAMDNITRQNQFYDTQVIKQEN
ESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRG
RGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFKVARDRSSGYPLTIEGFA
YLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPF
SYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQK
EALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTVGPKSKAE
CEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVL
IQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKD
RTIKRTDEEGKDVPDHAVLEMKANFTLPDVGDFLDEVLFIELQREEADKLVRQYNEEGRK
AGPPPEKRFDNRGGGGFRGRGGGGGFQRYENRGPPGGNRGGFQNRGGGSGGGGNYRGGFN
RSGGGGYSQNRWGNNNRDNNNSNNRGSYNRAPQQQPPPQQPPPPQPPPQQPPPPPSYSPA
RNPPGASTYNKNSNIPGSSANTSTPTVSSYSPPQPSYSQPPYNQGGYSQGYTAPPPPPPP
PPAYNYGSYGGYNPAPYTPPPPPTAQTYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNY
DYGSYSGNTQGGTSTQ
NT seq 2571 nt   +upstreamnt  +downstreamnt
atggatgtgcgccgtctgaaggtgaacgaacttcgcgaggagctgcagcgccgcggcctg
gacactcgaggcctcaaggccgagcttgctgagcggctgcaggcggcgttggaggccgag
gagcctgacgacgagcgggagctcgacgccgacgacgaaccggggcgacccgggcacatc
aacgaggaggtcgagaccgaggggggctccgagctggaggggaccgcgcagccaccgccg
cccgggctgcagccgcacgcggagcccggcggctactcggggccggacggacattatgcc
atggacaatattaccaggcagaaccaattctacgatacccaagtcatcaaacaagaaaac
gagtcaggctacgagaggagaccactggaaatggagcagcagcaggcctatcgtccagaa
atgaagacagagatgaagcaaggagcacccaccagcttcctcccgcctgaagcttctcaa
ctcaagccagacaggcagcaattccagagtcgaaagaggccttatgaagaaaaccgggga
cgggggtactttgagcaccgagaggataggaggggccgctctcctcagcctcctgctgaa
gaggatgaagatgactttgatgatacccttgttgctattgacacctataactgcgacctc
cacttcaaggtggcccgagatcggagtagtggctatccgctcacaattgagggctttgca
tacctgtggtcaggagcccgtgccagctatggggtcagaaggggccgtgtatgcttcgag
atgaagatcaatgaggaaatctccgtgaagcaccttccgtctacagagcctgacccccac
gtggtccgtatcggctggtccctggactcctgcagcacccagctaggcgaagagcctttc
tcctatggctatggaggcactgggaagaagtccaccaatagccggtttgaaaactacgga
gacaagtttgcagagaacgatgtgattggctgctttgcggattttgaatgtggaaatgac
gtggaactgtcttttaccaagaatggaaagtggatgggcattgctttccgaatccagaag
gaagccttggggggtcaggccctctatcctcatgtcctggtgaagaattgcgcagtggag
ttcaacttcggacagagagcagagccctactgttctgtcctcccggggtttaccttcatc
cagcaccttccccttagtgagcgtatccggggcaccgttggaccaaagagcaaggcagaa
tgtgagattctgatgatggtgggcctgcctgctgctggcaagaccacatgggccatcaaa
catgcagcctccaacccttccaagaagtacaacatcctgggtaccaatgccatcatggat
aagatgcgggtgatgggcctacgccggcagcggaactatgctggccgctgggatgtcctg
atccagcaggccacccagtgcctcaaccgcctcatccagattgctgcccgcaagaaacgc
aactatatcctagatcagacaaatgtttatgggtcagcccagagacgaaaaatgagacca
tttgaaggcttccagcgcaaagctattgtaatttgtcccactgacgaggacctaaaagac
cgaacaataaagcgaaccgacgaggaagggaaggatgtcccagatcatgcggtcttagaa
atgaaagccaacttcacgttgccagatgttggggacttcctggatgaggttctgttcatt
gagctgcagcgggaggaagcggacaagctagtgaggcagtacaacgaggaaggccgcaag
gctgggccaccccctgaaaagcgctttgacaaccgaggtggtggtggcttccggggccgc
gggggtggtggtggcttccagcgctatgaaaaccgaggaccccctggaggcaaccgtggc
ggcttccagaaccgagggggaggcagcggtggaggaggcaactaccgaggaggtttcaac
cgcagcggaggtggtggctatagccagaaccgctggggtaacaacaaccgggataacaac
aactccaacaacagaggcagctacaaccgggctccccagcaacagccgccaccacagcag
cctccgccaccacagccaccaccccagcagccaccgccaccacccagctacagccctgct
cggaaccccccaggggccagcacctacaataagaacagcaacatccctggctcaagcgcc
aataccagcacccccaccgtcagcagctacagccctccacagccgagttacagccagcca
ccctacaaccagggaggttacagccagggctacacagccccaccgcctccacctccacca
ccacctgcctacaactatgggagctacggcggttacaacccggccccctataccccaccg
ccaccccccactgcacagacctaccctcagcccagctataaccagtatcagcagtatgcc
cagcagtggaaccagtactatcagaaccagggccagtggccgccatactacgggaactac
gactacgggagctactccgggaacacacagggtggcacaagtacacagtag

DBGET integrated database retrieval system