KEGG   Homo sapiens (human): 11108
Entry
11108             CDS       T01001                                 
Symbol
PRDM4, PFM1
Name
(RefSeq) PR/SET domain 4
  KO
K12463  PR domain zinc finger protein 4 [EC:2.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    11108 (PRDM4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    11108 (PRDM4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-
     11108 (PRDM4)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    11108 (PRDM4)
SSDB
Motif
Pfam: zf_PR_Knuckle zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-met zf-H2C2_5 Mu-like_Com
Other DBs
NCBI-GeneID: 11108
NCBI-ProteinID: NP_036538
OMIM: 605780
HGNC: 9348
Ensembl: ENSG00000110851
Pharos: Q9UKN5(Tbio)
UniProt: Q9UKN5 A0A024RBM7 B3KPI0
Structure
LinkDB
Position
12:complement(107732871..107761137)
AA seq 801 aa
MHHRMNEMNLSPVGMEQLTSSSVSNALPVSGSHLGLAASPTHSAIPAPGLPVAIPNLGPS
LSSLPSALSLMLPMGIGDRGVMCGLPERNYTLPPPPYPHLESSYFRTILPGILSYLADRP
PPQYIHPNSINVDGNTALSITNNPSALDPYQSNGNVGLEPGIVSIDSRSVNTHGAQSLHP
SDGHEVALDTAITMENVSRVTSPISTDGMAEELTMDGVAGEHSQIPNGSRSHEPLSVDSV
SNNLAADAVGHGGVIPMHGNGLELPVVMETDHIASRVNGMSDSALSDSIHTVAMSTNSVS
VALSTSHNLASLESVSLHEVGLSLEPVAVSSITQEVAMGTGHVDVSSDSLSFVSPSLQME
DSNSNKENMATLFTIWCTLCDRAYPSDCPEHGPVTFVPDTPIESRARLSLPKQLVLRQSI
VGAEVGVWTGETIPVRTCFGPLIGQQSHSMEVAEWTDKAVNHIWKIYHNGVLEFCIITTD
ENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSRDYAQQIGVPE
HPDVHLCNCGKECNSYTEFKAHLTSHIHNHLPTQGHSGSHGPSHSKERKWKCSMCPQAFI
SPSKLHVHFMGHMGMKPHKCDFCSKAFSDPSNLRTHLKIHTGQKNYRCTLCDKSFTQKAH
LESHMVIHTGEKNLKCDYCDKLFMRRQDLKQHVLIHTQERQIKCPKCDKLFLRTNHLKKH
LNSHEGKRDYVCEKCTKAYLTKYHLTRHLKTCKGPTSSSSAPEEEEEDDSEEEDLADSVG
TEDCRINSAVYSADESLSAHK
NT seq 2406 nt   +upstreamnt  +downstreamnt
atgcatcacaggatgaatgaaatgaacctgagtccagtggggatggagcagctgacttca
tcctctgtgagcaatgccttgccagtctcaggaagtcacctgggattggctgcctcaccc
actcacagtgccatccctgccccaggcctcccagtggcaattccaaacctgggtccctcc
ctgagctctctgccttctgctctgtctttaatgctaccaatgggtattggggatcgaggg
gtgatgtgtgggttacctgaaagaaactacaccctacctccaccaccttaccctcacctg
gagagcagttatttcagaaccattctacctggcattttatcttatttagctgacagacca
cctccacagtacatccaccctaactctataaatgttgatggtaatacagcattatctatc
accaataacccttcagcactagatccctatcagtccaatggaaatgttggattagaacca
ggcattgtttcaatagactctcgctctgtgaacacacatggtgcccaaagtcttcatccc
agtgatggccatgaggtggccttggacacagcaatcactatggagaacgtttctagggtt
accagcccaatttcgacagatggaatggcagaggagcttacgatggacggtgttgcaggc
gagcattcccaaatcccaaatggctccagaagtcatgaacctctgtctgtggattctgtg
agcaacaaccttgcagcagacgctgtaggacatggtggtgtgatacccatgcatgggaat
ggcctggagctccctgtggtcatggagacagaccacattgcaagtcgggtcaatggcatg
tctgacagtgccctcagtgactccattcacactgtggccatgagcaccaactctgtaagc
gtggcactctctacctcacacaaccttgcctccctagaatctgtttccctccatgaagtt
ggcctcagcctagaacctgtggctgtctcctccatcacccaggaggttgctatggggaca
ggtcatgtagatgtatcttcagacagtctttcttttgtatcaccttcactgcaaatggaa
gactccaattcaaacaaggagaacatggcaaccttgtttacaatttggtgtactctgtgt
gaccgcgcctatccctcggactgtcccgaacatggaccagtgacttttgttcctgacact
ccaatagagagcagagcaaggctttctctcccaaagcagcttgttctccgtcagtcaatt
gtgggagcagaagttggtgtatggactggagaaaccattcctgtgcggacttgctttgga
cctctaattggccagcagagtcactccatggaagtagcagaatggacagacaaggcagtt
aaccatatctggaagatataccacaatggtgtcctagaattctgcatcattacaactgat
gaaaatgaatgtaattggatgatgtttgtgcgcaaagccaggaaccgggaagagcagaat
ttggtggcttatcctcatgatggaaaaatctttttctgcacctcacaagatatccctcct
gaaaatgaactgcttttttattatagccgagattatgctcaacagattggtgttcctgaa
cacccagatgtgcatctctgtaactgtggcaaggagtgcaattcttacacagagttcaaa
gcccatctgaccagccacatccataaccatcttcctacccagggacatagcggcagccat
gggccaagtcacagcaaagaaaggaagtggaagtgctcaatgtgcccccaagcttttatc
tctccttccaaacttcatgtccactttatgggtcacatgggtatgaagccccacaagtgt
gatttctgtagcaaggcttttagtgatcccagcaacctgcggacccacctcaagatacat
acaggtcagaagaactacaggtgtaccttgtgtgacaagtctttcacccagaaggctcac
ctggagtcccacatggttatccacactggggagaagaatcttaagtgtgattactgtgac
aagttgtttatgcggaggcaggacctcaagcagcacgtgctcatccacactcaagaacgc
cagatcaagtgtcccaagtgtgataagctgttcttgagaacaaatcacttaaagaagcat
ctcaattctcatgaaggaaaacgggattatgtctgtgaaaaatgtacaaaggcttatcta
accaaataccatctcacccgccacctgaaaacctgcaaagggcccacctccagttcgtca
gcaccagaggaggaagaagaggatgactcagaagaggaagatctagcagactctgtgggg
acagaagactgtaggattaacagtgctgtgtattcagcggatgagtctctttctgcacat
aaataa

DBGET integrated database retrieval system