KEGG   Homo sapiens (human): 11112
Entry
11112             CDS       T01001                                 
Symbol
HIBADH, NS5ATP1
Name
(RefSeq) 3-hydroxyisobutyrate dehydrogenase
  KO
K00020  3-hydroxyisobutyrate dehydrogenase [EC:1.1.1.31]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00280  Valine, leucine and isoleucine degradation
hsa01100  Metabolic pathways
Network
nt06024  Valine, leucine and isoleucine degradation
  Element
N00852  Valine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    11112 (HIBADH)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.31  3-hydroxyisobutyrate dehydrogenase
     11112 (HIBADH)
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_11 2-Hacid_dh_C F420_oxidored 3HCDH_N IlvN TrkA_N
Other DBs
NCBI-GeneID: 11112
NCBI-ProteinID: NP_689953
OMIM: 608475
HGNC: 4907
Ensembl: ENSG00000106049
Vega: OTTHUMG00000097035
Pharos: P31937(Tbio)
UniProt: P31937 A0A024RA75
Structure
LinkDB
Position
7:complement(27525442..27662883)
AA seq 336 aa
MAASLRLLGAASGLRYWSRRLRPAAGSFAAVCSRSVASKTPVGFIGLGNMGNPMAKNLMK
HGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGIL
KKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVED
EFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLL
AKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPI
LLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEETF
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggcagcctccttacggctcctcggagctgcctccggtctccggtactggagccggcgg
ctgcggccggcagccggcagctttgcagcggtgtgttctaggtcagtggcttcaaagact
ccagttggattcattggactgggcaacatggggaatccaatggcaaaaaatctcatgaaa
catggctatccacttattatttatgatgtgttccctgatgcctgcaaagagtttcaagat
gcaggtgaacaggtagtatcttccccagcagatgttgctgaaaaagctgacagaattatt
acaatgctgcccaccagtatcaatgcaatagaagcttattccggagcaaatgggattcta
aaaaaagtgaagaagggctcattattaatagattccagcactattgatcctgcagtttca
aaagaattggccaaagaagttgagaaaatgggagcagttttcatggatgcccctgtttct
ggtggtgtaggagctgcacgatctgggaacctcacgtttatggtgggaggagttgaagat
gaatttgctgctgcccaagagttgctggggtgcatgggctccaacgtggtgtactgtgga
gctgttgggactgggcaggcggcaaagatctgcaacaacatgctgttagctattagtatg
attggaactgctgaagctatgaatcttggaatcaggttagggcttgacccaaaactactg
gctaaaatcctaaatatgagctcaggacggtgttggtcaagtgacacttataatcctgta
cctggagtgatggatggcgttccctcggctaataactatcagggtggatttggaacaaca
ctcatggctaaggatctgggattggcacaagactctgctaccagcacaaagagcccaatc
cttcttggcagtctggcccatcagatctacaggatgatgtgtgcaaagggctactcaaag
aaagacttctcatccgtgttccagttcctacgagaggaggagaccttctga

DBGET integrated database retrieval system