KEGG   Homo sapiens (human): 11124
Entry
11124             CDS       T01001                                 
Symbol
FAF1, CGI-03, HFAF1s, UBXD12, UBXN3A, hFAF1
Name
(RefSeq) Fas associated factor 1
  KO
K20703  FAS-associated factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    11124 (FAF1)
SSDB
Motif
Pfam: UBX UBA_4 ubiquitin Borrelia_P83
Other DBs
NCBI-GeneID: 11124
NCBI-ProteinID: NP_008982
OMIM: 604460
HGNC: 3578
Ensembl: ENSG00000185104
Pharos: Q9UNN5(Tbio)
UniProt: Q9UNN5
Structure
LinkDB
Position
1:complement(50437028..50960267)
AA seq 650 aa
MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGET
IPGPAFNPASHPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDTC
TVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSS
SHAGALQESLNQNFMLIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGW
PTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEEQITDVHMVSDSDGDDFEDAT
EFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAA
FQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSN
RARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRL
MAAMEIFTAQQQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLE
QIRKEQEEEREAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVF
DFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
NT seq 1953 nt   +upstreamnt  +downstreamnt
atggcgtccaacatggaccgggagatgatcctggcggattttcaggcatgtactggcatt
gaaaacattgacgaagctattacattgcttgaacaaaataattgggacttagtggcagct
atcaatggtgtaataccacaggaaaatggcattctacaaagtgaatatggaggtgagacc
ataccaggacctgcatttaatccagcaagtcatccagcttcagctcctacttcctcttct
tcttcagcgtttcgacctgtaatgccatccaggcagattgtagaaaggcaacctcggatg
ctggacttcagggttgaatacagagacagaaatgttgatgtggtacttgaagacacctgt
actgttggagagattaaacagattctagaaaatgaacttcagatacctgtgtccaaaatg
ctgttaaaaggctggaagacgggagatgtggaagacagtacggtcctaaaatctctacac
ttgccaaaaaacaacagtctttatgtccttacaccagatttgccaccaccttcatcatct
agtcatgctggtgccctgcaggagtcattaaatcaaaacttcatgctgatcatcacccac
cgagaagtccagcgggagtacaacctgaacttctcaggaagcagtactattcaagaggta
aagagaaatgtgtatgaccttacaagtatccccgttcgccaccaattatgggagggctgg
ccaacttctgctacagacgactcaatgtgtcttgctgaatcagggctctcttatccctgc
catcgacttacagtgggaagaagatcttcacctgcacagacccgggaacagtcggaagaa
caaatcaccgatgttcatatggttagtgatagcgatggagatgactttgaagatgctaca
gaatttggggtggatgatggagaagtatttggcatggcgtcatctgccttgagaaaatct
ccaatgatgccagaaaacgcagaaaatgaaggagatgccttattacaatttacagcagag
ttttcttcaagatatggtgattgccatcctgtattttttattggctcattagaagctgct
tttcaagaggccttctatgtgaaagcccgagatagaaagcttcttgctatctacctccac
catgatgaaagtgtgttaaccaacgtgttctgctcacaaatgctttgtgctgaatccatt
gtttcttatctgagtcaaaattttataacctgggcttgggatctgacaaaggactccaac
agagcaagatttctcactatgtgcaatagacactttggcagtgttgtggcacaaaccatt
cggactcaaaaaacggatcagtttccgcttttcctgattattatgggaaagcgatcatct
aatgaagtgttgaatgtgatacaagggaacacaacagtagatgagttaatgatgagactc
atggctgcaatggagatcttcacagcccaacaacaggaagatataaaggacgaggatgaa
cgtgaagccagagaaaatgtgaagagagagcaagatgaggcctatcgcctttcacttgag
gctgacagagcaaagagggaagctcacgagagagagatggcagaacagtttcgtttggag
cagattcgcaaagaacaagaagaggaacgtgaggccatccggctgtccttagagcaagcc
ctgcctcctgagccaaaggaagaaaatgctgagcctgtgagcaaactgcggatccggacc
cccagtggcgagttcttggagcggcgtttcctggccagcaacaagctccagattgtcttt
gattttgtagcttccaaaggatttccatgggatgagtacaagttactgagcacctttcct
aggagagacgtaactcaactggacccaaataaatcattattggaggtaaagttgttccct
caagaaacccttttccttgaagcaaaagagtaa

DBGET integrated database retrieval system