KEGG   Homo sapiens (human): 11140
Entry
11140             CDS       T01001                                 
Symbol
CDC37, P50CDC37
Name
(RefSeq) cell division cycle 37, HSP90 cochaperone
  KO
K09554  cell division cycle protein 37
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    11140 (CDC37)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    11140 (CDC37)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    11140 (CDC37)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    11140 (CDC37)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  Cdc37 / p50
   11140 (CDC37)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    11140 (CDC37)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Intracellular proteins
   11140 (CDC37)
SSDB
Motif
Pfam: CDC37_M CDC37_C CDC37_N CATRA-C Med4 T3SSipB
Other DBs
NCBI-GeneID: 11140
NCBI-ProteinID: NP_008996
OMIM: 605065
HGNC: 1735
Ensembl: ENSG00000105401
Pharos: Q16543(Tbio)
UniProt: Q16543 A0A024R7B7
Structure
LinkDB
Position
19:complement(10391133..10403542)
AA seq 378 aa
MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRK
VAECQRKLKELEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLS
KDGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVH
LVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTK
IKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYES
LPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASEAKEGEEAGPG
DPLLEAVPKTGDEKDVSV
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggtggactacagcgtgtgggaccacattgaggtgtctgatgatgaagacgagacgcac
cccaacatcgacacggccagtctcttccgctggcggcatcaggcccgggtggaacgcatg
gagcagttccagaaggagaaggaggaactggacaggggctgccgcgagtgcaagcgcaag
gtggccgagtgccagaggaaactgaaggagctggaggtggccgagggcggcaaggcagag
ctggagcgcctgcaggccgaggcacagcagctgcgcaaggaggagcggagctgggagcag
aagctggaggagatgcgcaagaaggagaagagcatgccctggaacgtggacacgctcagc
aaagacggcttcagcaagagcatggtaaataccaagcccgagaagacggaggaggactca
gaggaggtgagggagcagaaacacaagaccttcgtggaaaaatacgagaaacagatcaag
cactttggcatgcttcgccgctgggatgacagccaaaagtacctgtcagacaacgtccac
ctggtgtgcgaggagacagccaattacctggtcatttggtgcattgacctagaggtggag
gagaaatgtgcactcatggagcaggtggcccaccagacaatcgtcatgcaatttatcctg
gagctggccaagagcctaaaggtggacccccgggcctgcttccggcagttcttcactaag
attaagacagccgatcgccagtacatggagggcttcaacgacgagctggaagccttcaag
gagcgtgtgcggggccgtgccaagctgcgcatcgagaaggccatgaaggagtacgaggag
gaggagcgcaagaagcggctcggccccggcggcctggaccccgtcgaggtctacgagtcc
ctccctgaggaactccagaagtgcttcgatgtgaaggacgtgcagatgctgcaggacgcc
atcagcaagatggaccccaccgacgcaaagtaccacatgcagcgctgcattgactctggc
ctctgggtccccaactctaaggccagcgaggccaaggagggagaggaggcaggtcctggg
gacccattactggaagctgttcccaagacgggcgatgagaaggatgtcagtgtgtga

DBGET integrated database retrieval system