KEGG   Homo sapiens (human): 11145
Entry
11145             CDS       T01001                                 

Gene name
PLAAT3, AdPLA, H-REV107, H-REV107-1, HRASLS3, HREV107, HREV107-1, HREV107-3, HRSL3, PLA2G16, PLAAT-3
Definition
(RefSeq) phospholipase A and acyltransferase 3
  KO
K16817  HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    11145 (PLAAT3)
   00565 Ether lipid metabolism
    11145 (PLAAT3)
   00590 Arachidonic acid metabolism
    11145 (PLAAT3)
   00591 Linoleic acid metabolism
    11145 (PLAAT3)
   00592 alpha-Linolenic acid metabolism
    11145 (PLAAT3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    11145 (PLAAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    11145 (PLAAT3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     11145 (PLAAT3)
    3.1.1.32  phospholipase A1
     11145 (PLAAT3)
SSDB
Motif
Pfam: LRAT Calici_PP_N Peptidase_C97 Churchill
Other DBs
NCBI-GeneID: 11145
NCBI-ProteinID: NP_001121675
OMIM: 613867
HGNC: 17825
Ensembl: ENSG00000176485
Vega: OTTHUMG00000167852
Pharos: P53816(Tbio)
UniProt: P53816 A0A024R561
LinkDB
Structure
PDB: 
4DOT 4FA0 2KYT

Position
11q12.3-q13.1
AA seq 162 aa
MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIV
KKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNEL
RYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ
NT seq 489 nt   +upstreamnt  +downstreamnt
atgcgtgcgcccattccagagcctaagcctggagacctgattgagatttttcgccctttc
tacagacactgggccatctatgttggcgatggatatgtggttcatctggcccctccaagt
gaggtcgcaggagctggtgcagccagtgtcatgtccgccctgactgacaaggccatcgtg
aagaaggaattgctgtatgatgtggccgggagtgacaagtaccaggtcaacaacaaacat
gatgacaagtactcgccgctgccctgcagcaaaatcatccagcgggcggaggagctggtg
gggcaggaggtgctctacaagctgaccagtgagaactgcgagcactttgtgaatgagctg
cgctatggagtcgcccgcagtgaccaggtcagagatgtcatcatcgctgcaagcgttgca
ggaatgggcttggcagccatgagccttattggagtcatgttctcaagaaacaagcgacaa
aagcaataa

DBGET integrated database retrieval system