KEGG   Homo sapiens (human): 11201
Entry
11201             CDS       T01001                                 

Symbol
POLI, RAD30B, RAD3OB, eta2
Name
(RefSeq) DNA polymerase iota
  KO
K03510  DNA polymerase iota [EC:2.7.7.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    11201 (POLI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    11201 (POLI)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     11201 (POLI)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    11201 (POLI)
SSDB
Motif
Pfam: IMS IMS_C Cdd1 IMS_HHH UBM HHH_5 DNA_pol_lambd_f TfoX_C RecG_wedge DUF4332
Other DBs
NCBI-GeneID: 11201
NCBI-ProteinID: NP_009126
OMIM: 605252
HGNC: 9182
Ensembl: ENSG00000101751
Vega: OTTHUMG00000132704
Pharos: Q9UNA4(Tbio)
UniProt: Q9UNA4
LinkDB
Structure
PDB: 

Position
18q21.2
AA seq 740 aa
MEKLGVEPEEEGGGDDDEEDAEAWAMELADVGAAASSQGVHDQVLPTPNASSRVIVHVDL
DCFYAQVEMISNPELKDKPLGVQQKYLVVTCNYEARKLGVKKLMNVRDAKEKCPQLVLVN
GEDLTRYREMSYKVTELLEEFSPVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSG
HVYNNQSINLLDVLHIRLLVGSQIAAEMREAMYNQLGLTGCAGVASNKLLAKLVSGVFKP
NQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKCLEALGINSVRDLQTFSPKILEKELGI
SVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSFKKCSSEVEAKNKIEELLASLLNRVCQD
GRKPHTVRLIIRRYSSEKHYGRESRQCPIPSHVIQKLGTGNYDVMTPMVDILMKLFRNMV
NVKMPFHLTLLSVCFCNLKALNTAKKGLIDYYLMPSLSTTSRSGKHSFKMKDTHMEDFPK
DKETNRDFLPSGRIESTRTRESPLDTTNFSKEKDINEFPLCSLPEGVDQEVFKQLPVDIQ
EEILSGKSREKFQGKGSVSCPLHASRGVLSFFSKKQMQDIPINPRDHLSSSKQVSSVSPC
EPGTSGFNSSSSSYMSSQKDYSYYLDNRLKDERISQGPKEPQGFHFTNSNPAVSAFHSFP
NLQSEQLFSRNHTTDSHKQTVATDSHEGLTENREPDSVDEKITFPSDIDPQVFYELPEAV
QKELLAEWKRAGSDFHIGHK
NT seq 2223 nt   +upstreamnt  +downstreamnt
atggagaagctgggggtggagccggaggaggaaggcggcggcgacgacgacgaggaagac
gccgaggcctgggccatggaactggcggacgtgggggcggcagccagctcgcagggagtt
catgatcaagtgttgcccacaccaaatgcttcatccagagtcatagtacatgtggatctg
gattgcttttatgcacaagtagaaatgatctcaaatccagagctaaaagacaaaccttta
ggggttcaacagaaatatttggtggttacctgcaactatgaagctaggaaacttggagtt
aagaaacttatgaatgtcagagatgcaaaagaaaagtgtccacagttggtattagttaat
ggagaagacctgacccgctacagagaaatgtcttataaggttacagaattactggaagaa
tttagtccagttgttgagagacttggatttgatgaaaattttgtggatctaacagaaatg
gttgagaagagactacagcagctgcaaagtgatgaactttctgcggtgactgtgtcgggt
catgtatacaataatcagtctataaacctgcttgacgtcttgcacatcagactacttgtt
ggatctcagattgcagcagagatgcgggaagccatgtataatcagttggggctcactggc
tgtgctggagtggcttctaataaactgttggcaaaattagtttctggtgtctttaaacca
aatcaacaaacagtcttattacctgaaagttgtcaacatcttattcatagtttgaatcac
ataaaggaaatacctggtattggctataaaactgccaaatgtcttgaagcactgggtatc
aatagtgtgcgtgatctccaaaccttttcacccaaaattttagaaaaagaattaggaatt
tcagttgctcagcgtatccaaaagctcagttttggagaggataactcccctgtgatactc
tcaggaccacctcagtcctttagtgaagaagattcatttaaaaaatgttcatctgaagtt
gaagctaaaaataagattgaagaactacttgctagtcttttaaacagagtatgccaagat
ggaaggaagcctcatacagtgagattaataatccgtcggtattcctctgagaagcactat
ggtcgtgagagtcgtcagtgccctattccttcacatgtaattcagaaattagggacagga
aattatgatgtgatgaccccaatggttgatatacttatgaaactttttcgaaatatggtg
aatgtgaagatgccatttcaccttacccttctaagtgtgtgcttctgcaaccttaaagca
ctaaatactgctaagaaagggcttattgattattatttaatgccatcattatcaactact
tcacgctctggcaagcacagttttaaaatgaaagacactcatatggaagattttcccaaa
gacaaagaaacaaaccgggatttcctaccaagtggaagaattgaaagtacaagaactagg
gagtctccactagataccacaaatttttctaaagaaaaagacattaatgaattcccactc
tgttcacttcctgaaggtgttgaccaagaagtcttcaagcagcttccagtagatattcaa
gaagaaatcctttctggaaaatctagggaaaaatttcaagggaaaggaagtgtgagttgt
ccattacatgcctctagaggagtattatctttcttttctaaaaaacaaatgcaagatatt
cccataaatcctagagatcatttatccagtagcaaacaggtatcctctgtatctccttgt
gaaccgggaacatcaggctttaatagcagtagttcttcttacatgtctagccaaaaggat
tattcatattatttagataatagattaaaagatgaacgaataagtcaaggacctaaagaa
cctcaaggattccactttacaaattcaaaccctgctgtgtctgcttttcattcatttcca
aacttgcagagtgagcaacttttctccagaaaccacactacagatagccataagcaaaca
gtagcaacagactctcatgaaggacttacagaaaatagagagccagattctgttgatgag
aaaattactttcccttctgacattgatcctcaagttttctatgaactaccagaagcagta
caaaaggaactgctggcagagtggaagagagcaggatcagatttccacattggacataaa
taa

DBGET integrated database retrieval system