KEGG   Homo sapiens (human): 11214Help
Entry
11214             CDS       T01001                                 

Gene name
AKAP13, AKAP-13, AKAP-Lbc, ARHGEF13, BRX, HA-3, Ht31, LBC, PRKA13, PROTO-LB, PROTO-LBC, c-lbc, p47
Definition
(RefSeq) A-kinase anchoring protein 13
  KO
K16529  A-kinase anchor protein 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    11214 (AKAP13)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    11214 (AKAP13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11214 (AKAP13)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    11214 (AKAP13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH_16 RhoGEF PH C1_1 RII_binding_1 Prok-RING_1 C1_2 Zf_RING
Motif
Other DBs
NCBI-GeneID: 11214
NCBI-ProteinID: NP_009131
OMIM: 604686
HGNC: 371
Ensembl: ENSG00000170776
Vega: OTTHUMG00000172205
Pharos: Q12802(Tbio)
UniProt: Q12802
LinkDB All DBs
Structure
PDB: 

Position
15q25.3
AA seq 2813 aa AA seqDB search
MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAP
GHDCCETVKVQLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQQALNFTRFLD
QSGPPSGDVNSLDKKLVLAFRHLKLPTEWNVLGTDQSLHDAGPRETLMHFAVRLGLLRLT
WFLLQKPGGRGALSIHNQEGATPVSLALERGYHKLHQLLTEENAGEPDSWSSLSYEIPYG
DCSVRHHRELDIYTLTSESDSHHEHPFPGDGCTGPIFKLMNIQQQLMKTNLKQMDSLMPL
MMTAQDPSSAPETDGQFLPCAPEPTDPQRLSSSEETESTQCCPGSPVAQTESPCDLSSIV
EEENTDRSCRKKNKGVERKGEEVEPAPIVDSGTVSDQDSCLQSLPDCGVKGTEGLSSCGN
RNEETGTKSSGMPTDQESLSSGDAVLQRDLVMEPGTAQYSSGGELGGISTTNVSTPDTAG
EMEHGLMNPDATVWKNVLQGGESTKERFENSNIGTAGASDVHVTSKPVDKISVPNCAPAA
SSLDGNKPAESSLAFSNEETSTEKTAETETSRSREESADAPVDQNSVVIPAAAKDKISDG
LEPYTLLAAGIGEAMSPSDLALLGLEEDVMPHQNSETNSSHAQSQKGKSSPICSTTGDDK
LCADSACQQNTVTSSGDLVAKLCDNIVSESESTTARQPSSQDPPDASHCEDPQAHTVTSD
PVRDTQERADFCPFKVVDNKGQRKDVKLDKPLTNMLEVVSHPHPVVPKMEKELVPDQAVI
SDSTFSLANSPGSESVTKDDALSFVPSQKEKGTATPELHTATDYRDGPDGNSNEPDTRPL
EDRAVGLSTSSTAAELQHGMGNTSLTGLGGEHEGPAPPAIPEALNIKGNTDSSLQSVGKA
TLALDSVLTEEGKLLVVSESSAAQEQDKDKAVTCSSIKENALSSGTLQEEQRTPPPGQDT
QQFHEKSISADCAKDKALQLSNSPGASSAFLKAETEHNKEVAPQVSLLTQGGAAQSLVPP
GASLATESRQEALGAEHNSSALLPCLLPDGSDGSDALNCSQPSPLDVGVKNTQSQGKTSA
CEVSGDVTVDVTGVNALQGMAEPRRENISHNTQDILIPNVLLSQEKNAVLGLPVALQDKA
VTDPQGVGTPEMIPLDWEKGKLEGADHSCTMGDAEEAQIDDEAHPVLLQPVAKELPTDME
LSAHDDGAPAGVREVMRAPPSGRERSTPSLPCMVSAQDAPLPKGADLIEEAASRIVDAVI
EQVKAAGALLTEGEACHMSLSSPELGPLTKGLESAFTEKVSTFPPGESLPMGSTPEEATG
SLAGCFAGREEPEKIILPVQGPEPAAEMPDVKAEDEVDFRASSISEEVAVGSIAATLKMK
QGPMTQAINRENWCTIEPCPDAASLLASKQSPECENFLDVGLGRECTSKQGVLKRESGSD
SDLFHSPSDDMDSIIFPKPEEEHLACDITGSSSSTDDTASLDRHSSHGSDVSLSQILKPN
RSRDRQSLDGFYSHGMGAEGRESESEPADPGDVEEEEMDSITEVPANCSVLRSSMRSLSP
FRRHSWGPGKNAASDAEMNHRSSMRVLGDVVRRPPIHRRSFSLEGLTGGAGVGNKPSSSL
EVSSANAEELRHPFSGEERVDSLVSLSEEDLESDQREHRMFDQQICHRSKQQGFNYCTSA
ISSPLTKSISLMTISHPGLDNSRPFHSTFHNTSANLTESITEENYNFLPHSPSKKDSEWK
SGTKVSRTFSYIKNKMSSSKKSKEKEKEKDKIKEKEKDSKDKEKDKKTVNGHTFSSIPVV
GPISCSQCMKPFTNKDAYTCANCSAFVHKGCRESLASCAKVKMKQPKGSLQAHDTSSLPT
VIMRNKPSQPKERPRSAVLLVDETATTPIFANRRSQQSVSLSKSVSIQNITGVGNDENMS
NTWKFLSHSTDSLNKISKVNESTESLTDEGVGTDMNEGQLLGDFEIESKQLEAESWSRII
DSKFLKQQKKDVVKRQEVIYELMQTEFHHVRTLKIMSGVYSQGMMADLLFEQQMVEKLFP
CLDELISIHSQFFQRILERKKESLVDKSEKNFLIKRIGDVLVNQFSGENAERLKKTYGKF
CGQHNQSVNYFKDLYAKDKRFQAFVKKKMSSSVVRRLGIPECILLVTQRITKYPVLFQRI
LQCTKDNEVEQEDLAQSLSLVKDVIGAVDSKVASYEKKVRLNEIYTKTDSKSIMRMKSGQ
MFAKEDLKRKKLVRDGSVFLKNAAGRLKEVQAVLLTDILVFLQEKDQKYIFASLDQKSTV
ISLKKLIVREVAHEEKGLFLISMGMTDPEMVEVHASSKEERNSWIQIIQDTINTLNRDED
EGIPSENEEEKKMLDTRARELKEQLHQKDQKILLLLEEKEMIFRDMAECSTPLPEDCSPT
HSPRVLFRSNTEEALKGGPLMKSAINEVEILQGLVSGNLGGTLGPTVSSPIEQDVVGPVS
LPRRAETFGGFDSHQMNASKGGEKEEGDDGQDLRRTESDSGLKKGGNANLVFMLKRNSEQ
VVQSVVHLYELLSALQGVVLQQDSYIEDQKLVLSERALTRSLSRPSSLIEQEKQRSLEKQ
RQDLANLQKQQAQYLEEKRRREREWEARERELREREALLAQREEEVQQGQQDLEKEREEL
QQKKGTYQYDLERLRAAQKQLEREQEQLRREAERLSQRQTERDLCQVSHPHTKLMRIPSF
FPSPEEPPSPSAPSIAKSGSLDSELSVSPKRNSISRTHKDKGPFHILSSTSQTNKGPEGQ
SQAPASTSASTRLFGLTKPKEKKEKKKKNKTSRSQPGDGPASEVSAEGEEIFC
NT seq 8442 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaatccacagcaagctcccttatatggtgattgtgttgttacagtgctgctt
gctgaagaggacaaagctgaagatgatgtagtgttttacttggtatttttgggttccacc
ctccgtcactgtacaagtactcggaaggtcagttctgatacattggagaccattgctcct
ggtcatgattgttgtgaaacagtgaaggtgcagctctgtgcttccaaagagggccttccc
gtgtttgtggtggctgaagaagactttcatttcgtccaggatgaagcgtatgatgcagct
caattcctagcaaccagtgctggaaatcagcaggctttgaactttacccgttttcttgac
cagtcaggacccccatctggggatgtgaattcccttgataagaagttggtgctggcattc
aggcacctgaagctgcccacggagtggaatgtattggggacagatcagagtttgcatgat
gctggcccgcgagagacattgatgcattttgctgtgcggctgggactgctgaggttgacg
tggttcctgttgcagaagccaggtggccgcggagctctcagtatccacaaccaggaaggg
gcgacgcctgtgagcttggccttggagcgaggctatcacaagctgcaccagcttctaacc
gaggagaatgctggagaaccagactcctggagcagtttatcctatgaaataccgtatgga
gactgttctgtgaggcatcatcgagagttggacatctatacattaacctctgagtctgat
tcacatcatgaacacccatttcctggagacggttgcactggaccaatttttaaacttatg
aacatccaacagcaactaatgaaaacaaacctcaagcagatggacagtcttatgccctta
atgatgacagcacaggatccttccagtgccccagagacagatggccagtttcttccctgt
gcaccggagcccacggaccctcagcgactttcttcttctgaagagactgagagcactcag
tgctgcccagggagccctgttgcacagactgaaagtccctgtgatttgtcaagcatagtt
gaggaggagaatacagaccgttcctgtaggaagaaaaataaaggcgtggaaagaaaaggg
gaagaggtggagccagcacctattgtggactctggaactgtatctgatcaagacagctgc
cttcagagcttgcctgattgtggagtaaagggcacggaaggcctttcgtcctgtggaaac
agaaatgaagaaactggaacaaaatcttctggaatgcccacagaccaggagtccctgagc
agtggagatgctgtgcttcagagagacttggtcatggagccaggcacagcccagtattcc
tctggaggtgaactgggaggcatttcaacaacaaatgtcagtaccccagacactgcaggg
gaaatggaacatgggctcatgaacccagatgccactgtttggaagaatgtgcttcaggga
ggggaaagtacaaaggaaagatttgagaactctaatattggcacagctggagcctctgac
gtgcacgtcacaagtaagcctgtggataaaatcagtgttccaaactgtgcccctgctgcc
agttccctggatggtaacaaacctgctgagtcttcacttgcatttagtaatgaagaaacc
tccactgaaaaaacagcagaaacggaaacttcacgaagtcgtgaggagagtgctgatgct
ccagtagatcagaattctgtggtgattccagctgctgcaaaagacaagatttcagatgga
ttagaaccttatactctcttagcagcaggcataggtgaggcaatgtcaccctcagattta
gcccttcttgggctggaagaagatgtaatgccacaccagaactcagaaacaaattcatct
catgctcaaagccaaaagggcaaatcctcacccatttgttctacaactggagacgataaa
ctttgtgcagactctgcatgtcaacagaacacagtgacttctagtggcgatttggttgca
aaactgtgtgataacatagttagcgagtccgaaagcaccacagcaaggcaacccagctca
caagatccacccgatgcctcccactgtgaagacccacaggctcatacagtcacctctgac
cctgtaagggatacccaggaacgtgcggatttttgtcctttcaaagtggtggataacaaa
ggccaacgaaaagatgtgaaactagataaacctttaacaaatatgcttgaggtggtttca
catccacatccagttgtccctaaaatggagaaagaactggtgccagaccaggcagtaata
tcagacagtactttctctctggcaaacagtccaggcagtgaatcagtaaccaaggatgac
gcactttcttttgtcccctcccagaaagaaaagggaacagcaactcctgaactacataca
gctacagattatagagatggcccagatggaaattcgaatgagcctgatacgcggccacta
gaagacagggcagtaggcctgtccacatcctccactgctgcagagcttcagcacgggatg
gggaataccagtctcacaggacttggtggagagcatgagggtcccgcccctccagcaatc
ccagaagctctgaatatcaaggggaacactgactcttccctgcaaagtgtgggtaaggcc
actttggctttagattcagttttgactgaagaaggaaaacttctggtggtttcagaaagc
tctgcagctcaggaacaagataaggataaagcggtgacctgttcctctattaaggaaaat
gctctctcttcaggaactttgcaggaagagcagagaacaccacctcctggacaagatact
caacaatttcatgaaaaatcaatctcagctgactgtgccaaggacaaagcacttcagcta
agtaattcaccgggtgcatcctctgcctttcttaaggcagaaactgaacataacaaggaa
gtggccccacaagtctcactgctgactcaaggtggggctgcccagagcctggtgccacca
ggagcaagtctggccacagagtcaaggcaggaagccttgggggcagagcacaacagctcc
gctctgttgccatgtctgttgccagatgggtctgatgggtccgatgctcttaactgcagt
cagccttctcctctggatgttggagtgaagaacactcaatcccagggaaaaactagtgcc
tgtgaggtgagtggagatgtgacggtggatgttacaggggttaatgctctacaaggtatg
gctgagcccagaagagagaatatatcacacaacacccaagacatcctgattccaaacgtc
ttgttgagccaagagaagaatgccgttctaggtttgccagtggctctacaggacaaagct
gtgactgacccacagggagttggaaccccagagatgatacctcttgattgggagaaaggg
aagctggagggagcagaccacagctgtaccatgggtgacgctgaggaagcccaaatagac
gatgaagcacatcctgtcctactgcagcctgttgccaaggagctccccacagacatggag
ctctcagcccatgatgatggggccccagctggtgtgagggaagtcatgcgagccccgcct
tcaggcagggaaaggagcactccctctctaccttgcatggtctctgcccaggacgcacct
ctgcctaagggggcagacttgatagaggaggctgccagccgtatagtggatgctgtcatc
gaacaagtcaaggccgctggagcactgcttactgagggggaggcctgtcacatgtcactg
tccagccctgagttgggtcctctcactaaaggactagagagtgcttttacagaaaaagtg
agtactttcccacctggggagagcctaccaatgggcagtactcctgaggaagccacgggg
agccttgcaggatgttttgctggaagggaggagccagagaagatcattttacctgtccag
gggcctgagccagcagcagaaatgccagacgtgaaagctgaagatgaagtggattttaga
gcaagttcaatttctgaagaagtggctgtagggagcatagctgctacactgaagatgaag
caaggcccaatgacccaggcgataaaccgagaaaactggtgtacaatagagccatgccct
gatgcagcatctcttctggcttccaagcagagcccagaatgtgagaacttcctggatgtt
ggactgggcagagagtgtacctcaaaacaaggtgtacttaaaagagaatctgggagtgat
tctgacctctttcactcacccagtgatgacatggacagcatcatcttcccaaagccagag
gaagagcatttggcctgtgatatcaccggatccagttcatccaccgatgacacggcttca
ctggaccgacattcttctcatggcagtgatgtgtctctctcccagattttaaagccaaac
aggtcaagagatcggcaaagccttgatggattctacagccatgggatgggagctgagggt
cgagaaagtgagagtgagcctgctgacccaggcgacgtggaggaggaggagatggacagt
atcactgaagtgcctgcaaactgctctgtcctaaggagctccatgcgctctctttctccc
ttccggaggcacagctgggggcctgggaaaaatgcagccagcgatgcagaaatgaaccac
cggagttcaatgcgagttcttggggatgttgtcaggagacctcccattcataggagaagt
ttcagtctagaaggcttgacaggaggagctggtgtcggaaacaagccatcctcatctcta
gaagtaagctctgcaaatgccgaagagctcagacacccattcagtggtgaggaacgggtt
gactctttggtgtcactttcagaagaggatctggagtcagaccagagagaacataggatg
tttgatcagcagatatgtcacagatctaagcagcagggatttaattactgtacatcagcc
atttcctctccattgacaaaatccatctcattaatgacaatcagccatcctggattggac
aattcacggcccttccacagtaccttccacaataccagtgctaatctgactgagagtata
acagaagagaactataatttcctgccacatagcccctccaagaaagattctgaatggaag
agtggaacaaaagtcagtcgtacattcagctacatcaagaataaaatgtctagcagcaag
aagagcaaagaaaaggaaaaagaaaaagataagattaaggagaaggagaaagattctaaa
gacaaggagaaagataagaagactgtcaacgggcacactttcagttccattcctgttgtg
ggtcccatcagctgtagccagtgtatgaagcccttcaccaacaaagatgcctatacttgt
gcaaattgcagtgcttttgtccacaaaggctgccgagaaagtctagcctcctgtgcaaag
gtcaaaatgaagcagcccaaagggagccttcaggcacatgacacatcatcactgcccacg
gtcattatgagaaacaagccctcacagcccaaggagcgtcctcggtccgcagtcctcctg
gtggatgaaaccgctaccaccccaatatttgccaatagacgatcccagcagagtgtctcg
ctctccaaaagtgtctccatacagaacattactggagttggcaatgatgagaacatgtca
aacacctggaaattcctgtctcattcaacagactcactaaataaaatcagcaaggtcaat
gagtcaacagaatcacttactgatgagggagtaggtacagacatgaatgaaggacaacta
ctgggagactttgagattgagtccaaacagctggaagcagagtcttggagtcggataata
gacagcaagtttctaaaacagcaaaagaaagatgtggtcaaacggcaagaagtaatatat
gagttgatgcagacagagtttcatcatgtccgcactctcaagatcatgagtggtgtgtac
agccaggggatgatggcggatctgctttttgagcagcagatggtagaaaagctgttcccc
tgtttggatgagctgatcagtatccatagccaattcttccagaggattctggagcggaag
aaggagtctctggtggataaaagtgaaaagaactttctcatcaagaggataggggatgtg
cttgtaaatcagttttcaggtgagaatgcagaacgtttaaagaagacatatggcaagttt
tgtgggcaacataaccagtctgtaaactacttcaaagacctttatgccaaggataagcgt
tttcaagcctttgtaaagaagaagatgagcagttcagttgttagaaggcttggaattcca
gagtgcatattgcttgtaactcagcggattaccaagtacccagttttattccaaagaata
ttgcagtgtaccaaagacaatgaagtggagcaggaagatctagcacagtccttgagcctg
gtgaaggatgtgattggagctgtagacagcaaagtggcaagttatgaaaagaaagtgcgt
ctcaatgagatttatacaaagacagatagcaagtcaatcatgaggatgaagagtggtcag
atgtttgccaaggaagatttgaaacggaagaagcttgtacgtgatgggagtgtgtttctg
aagaatgcagcaggaaggttgaaagaggttcaagcagttcttctcactgacattttagtt
ttccttcaagaaaaagaccagaagtacatctttgcatcattggaccagaagtcaacagtg
atctctttaaagaagctgattgtgagagaagtggcacatgaggagaaaggtttattcctg
atcagcatggggatgacagatccagagatggtagaagtccatgccagctccaaagaggaa
cgaaacagctggattcagatcattcaggacacaatcaacaccctgaacagagatgaagat
gaaggaattcctagtgagaatgaggaagaaaagaaaatgttggacaccagagcccgagaa
ttaaaagaacaacttcaccagaaggaccaaaaaatcctactcttgttggaagagaaggag
atgattttccgggacatggctgagtgcagcacccctctcccagaggattgctccccaaca
catagccctagagttctcttccgctccaacacagaagaggctctcaaaggaggaccttta
atgaaaagtgcaataaatgaggtggagatccttcagggtttggtgagtggaaatctggga
ggcacacttgggccgactgtcagcagccccattgagcaagatgtggtcggtcccgtttcc
ctgccccggagagcagagacctttggaggatttgacagccatcagatgaatgcttcaaaa
ggaggcgagaaggaagagggagatgatggccaagatcttaggagaacggaatcagatagt
ggcctaaaaaagggtggaaatgctaacctggtatttatgcttaaaagaaacagtgagcag
gttgtccagagcgttgttcatctctacgagctcctcagcgctctgcagggtgtggtgctg
cagcaggacagctacattgaggaccagaaactggtgctgagcgagagggcgctcactcgc
agcttgtcccgcccgagctccctcattgagcaggagaagcagcgcagcctggagaagcag
cgccaggacctggccaacctgcagaagcagcaggcccagtacctcgaggagaagcgcagg
cgcgagcgtgagtgggaagctcgtgagagggagctgcgggagcgggaggccctcctggcc
cagcgcgaggaggaggtgcagcaggggcagcaggacctggaaaaggagcgggaggagctc
cagcagaagaagggcacataccagtatgacctggagcgactgcgtgctgcccagaaacag
cttgagagggaacaggagcagctgcgccgggaggcagagcggctcagccagcggcagaca
gaacgggacctgtgtcaggtttcccatccacataccaagctgatgaggatcccatcgttc
ttccccagtcctgaggagcccccctcgccatctgcaccttccatagccaaatcagggtca
ttggactcagaactttcagtgtccccaaaaaggaacagcatctctcggacacacaaagat
aaggggccttttcacatactgagttcaaccagccagacaaacaaaggaccagaagggcag
agccaggcccctgcgtccacctctgcctctacccgcctgtttgggttaacaaagccaaag
gaaaagaaggagaaaaaaaagaagaacaaaaccagccgctctcagcccggtgatggtccc
gcgtcagaagtatcagcagagggtgaagagatcttctgctga

DBGET integrated database retrieval system