KEGG   Homo sapiens (human): 112744
Entry
112744            CDS       T01001                                 
Symbol
IL17F, CANDF6, IL-17F, IL17A, ML-1, ML1
Name
(RefSeq) interleukin 17F
  KO
K05494  interleukin 17F
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04657  IL-17 signaling pathway
hsa04659  Th17 cell differentiation
hsa05321  Inflammatory bowel disease
Disease
H01109  Chronic mucocutaneous candidiasis
Drug target
Afasevikumab: D10902
Bimekizumab: D11550<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112744 (IL17F)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112744 (IL17F)
   04657 IL-17 signaling pathway
    112744 (IL17F)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    112744 (IL17F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    112744 (IL17F)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   112744 (IL17F)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 112744
NCBI-ProteinID: NP_443104
OMIM: 606496
HGNC: 16404
Ensembl: ENSG00000112116
Vega: OTTHUMG00000014845
Pharos: Q96PD4(Tbio)
UniProt: Q96PD4
Structure
LinkDB
Position
6:complement(52236681..52245689)
AA seq 163 aa
MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIG
IINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNS
VPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
NT seq 492 nt   +upstreamnt  +downstreamnt
atgacagtgaagaccctgcatggcccagccatggtcaagtacttgctgctgtcgatattg
gggcttgcctttctgagtgaggcggcagctcggaaaatccccaaagtaggacatactttt
ttccaaaagcctgagagttgcccgcctgtgccaggaggtagtatgaagcttgacattggc
atcatcaatgaaaaccagcgcgtttccatgtcacgtaacatcgagagccgctccacctcc
ccctggaattacactgtcacttgggaccccaaccggtacccctcggaagttgtacaggcc
cagtgtaggaacttgggctgcatcaatgctcaaggaaaggaagacatctccatgaattcc
gttcccatccagcaagagaccctggtcgtccggaggaagcaccaaggctgctctgtttct
ttccagttggagaaggtgctggtgactgttggctgcacctgcgtcacccctgtcatccac
catgtgcagtaa

KEGG   Homo sapiens (human): 3605
Entry
3605              CDS       T01001                                 
Symbol
IL17A, CTLA-8, CTLA8, IL-17, IL-17A, IL17, ILA17
Name
(RefSeq) interleukin 17A
  KO
K05489  interleukin 17A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04657  IL-17 signaling pathway
hsa04659  Th17 cell differentiation
hsa04936  Alcoholic liver disease
hsa05321  Inflammatory bowel disease
hsa05323  Rheumatoid arthritis
Drug target
Afasevikumab: D10902
Bimekizumab: D11550<JP>
Ixekizumab: D10071<JP/US>
Izokibep: D12278
Secukinumab: D09967<JP/US>
Tibulizumab: D11127
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3605 (IL17A)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    3605 (IL17A)
   04657 IL-17 signaling pathway
    3605 (IL17A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    3605 (IL17A)
   05321 Inflammatory bowel disease
    3605 (IL17A)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3605 (IL17A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3605 (IL17A)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3605 (IL17A)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 3605
NCBI-ProteinID: NP_002181
OMIM: 603149
HGNC: 5981
Ensembl: ENSG00000112115
Vega: OTTHUMG00000014840
Pharos: Q16552(Tclin)
UniProt: Q16552
Structure
LinkDB
Position
6:52186375..52190638
AA seq 155 aa
MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNP
KRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEIL
VLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
NT seq 468 nt   +upstreamnt  +downstreamnt
atgactcctgggaagacctcattggtgtcactgctactgctgctgagcctggaggccata
gtgaaggcaggaatcacaatcccacgaaatccaggatgcccaaattctgaggacaagaac
ttcccccggactgtgatggtcaacctgaacatccataaccggaataccaataccaatccc
aaaaggtcctcagattactacaaccgatccacctcaccttggaatctccaccgcaatgag
gaccctgagagatatccctctgtgatctgggaggcaaagtgccgccacttgggctgcatc
aacgctgatgggaacgtggactaccacatgaactctgtccccatccagcaagagatcctg
gtcctgcgcagggagcctccacactgccccaactccttccggctggagaagatactggtg
tccgtgggctgcacctgtgtcaccccgattgtccaccatgtggcctaa

DBGET integrated database retrieval system