KEGG   Homo sapiens (human): 112936
Entry
112936            CDS       T01001                                 
Symbol
VPS26B, Pep8b
Name
(RefSeq) VPS26, retromer complex component B
  KO
K18466  vacuolar protein sorting-associated protein 26A/B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112936 (VPS26B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    112936 (VPS26B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    112936 (VPS26B)
SSDB
Motif
Pfam: Vps26 Arrestin_N Arrestin_C
Other DBs
NCBI-GeneID: 112936
NCBI-ProteinID: NP_443107
OMIM: 610027
HGNC: 28119
Ensembl: ENSG00000151502
Pharos: Q4G0F5(Tdark)
UniProt: Q4G0F5 A0A024R3L9
LinkDB
Position
11:134224671..134247788
AA seq 336 aa
MSFFGFGQSVEVEILLNDAESRKRAEHKTEDGKKEKYFLFYDGETVSGKVSLALKNPNKR
LEHQGIKIEFIGQIELYYDRGNHHEFVSLVKDLARPGEITQSQAFDFEFTHVEKPYESYT
GQNVKLRYFLRATISRRLNDVVKEMDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNK
SKYHLKDVIVGKIYFLLVRIKIKHMEIDIIKRETTGTGPNVYHENDTIAKYEIMDGAPVR
GESIPIRLFLAGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR
KSMSHQAAIASQRFEGTTSLGEVRTPSQLSDNNCRQ
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgagcttcttcggcttcgggcagagcgtggaggtggaaatccttctgaacgatgcagag
agtaggaagcgggccgagcacaagacggaggacgggaagaaggagaaatatttcctcttc
tacgacggggagacggtctccgggaaggtgagccttgccctcaagaaccccaacaagcgg
ctggagcaccagggcatcaagatcgagttcatcgggcagatcgaactctactacgatcgc
gggaaccaccatgagtttgtgtccctggtgaaggacctggcccggcctggagagatcacc
cagtcgcaggccttcgactttgagtttacccacgtggagaagccgtatgagtcctacaca
gggcagaatgtgaagctacgctatttccttcgtgctaccatcagccgccgcctcaatgat
gttgtcaaagagatggacattgtagttcacacactcagcacatacccagagctgaactct
tccatcaagatggaggttgggattgaggactgtctgcacattgaatttgagtacaataaa
tccaaataccacttgaaagatgtcattgtagggaagatatacttcctgctggtgagaatc
aaaatcaagcacatggagatagacatcatcaagcgagaaacgacgggtacaggccccaac
gtgtaccatgagaatgacacgatagccaagtacgagatcatggacggggcaccagtgcga
ggagagtccatcccgatccggctcttcctggccgggtatgagctcacgcccaccatgcgg
gacatcaacaagaagttctctgtgcgctattacctcaacctggtgctgatagacgaggag
gagcggcgctacttcaagcagcaggaagtggtgttgtggcggaagggtgacatcgtacgg
aagagcatgtcccaccaggcggccatcgcctcacagcgctttgagggcaccacctccctg
ggtgaggtgcggacccccagccagctgtctgacaacaactgcaggcagtag

KEGG   Homo sapiens (human): 9559
Entry
9559              CDS       T01001                                 
Symbol
VPS26A, HB58, Hbeta58, PEP8A, VPS26
Name
(RefSeq) VPS26, retromer complex component A
  KO
K18466  vacuolar protein sorting-associated protein 26A/B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9559 (VPS26A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9559 (VPS26A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    9559 (VPS26A)
SSDB
Motif
Pfam: Vps26 Arrestin_N Arrestin_C
Other DBs
NCBI-GeneID: 9559
NCBI-ProteinID: NP_004887
OMIM: 605506
HGNC: 12711
Ensembl: ENSG00000122958
Pharos: O75436(Tbio)
UniProt: O75436
Structure
LinkDB
Position
10:69124178..69174412
AA seq 327 aa
MSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPG
KRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYES
YIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEY
NKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETIAKYEIMDGAP
VKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPE
KLRKQRTNFHQRFESPESQASAEQPEM
NT seq 984 nt   +upstreamnt  +downstreamnt
atgagttttcttggaggcttttttggtccaatttgtgagatcgatattgttcttaatgat
ggggaaaccaggaaaatggcagaaatgaaaactgaagatggcaaagtagaaaaacactat
ctcttctatgacggagaatccgtttcaggaaaggtaaacctagcctttaagcaacctgga
aagaggctagaacaccaaggaattagaattgaatttgtaggtcaaattgaacttttcaat
gacaagagtaatactcatgaatttgtaaacctagtgaaagaactagccttacctggagaa
ctgactcagagcagaagttatgattttgaatttatgcaagttgaaaagccatatgaatct
tacatcggtgccaatgtccgcttgaggtattttcttaaagtgacaatagtgagaagactg
acagatttggtaaaagagtatgatcttattgttcaccagcttgccacctatcctgatgtt
aacaactctattaagatggaagtgggcattgaagattgtctacatatagaatttgaatat
aataaatcaaagtatcatttaaaggatgtgattgttggaaaaatttacttcttattagta
agaataaaaatacaacatatggagttacagctgatcaaaaaagagatcacaggaattgga
cccagtaccacaacagaaacagaaacaatcgccaaatatgaaataatggatggtgcacca
gtaaaaggtgaatcaattccaataaggctatttttagcaggatatgacccaactccaaca
atgagagatgtgaacaaaaaattttcagtaaggtactttttgaatttagtgcttgttgat
gaggaagaccggaggtacttcaaacagcaggagataattttatggagaaaagctcctgaa
aaactgaggaaacagagaacaaactttcaccagcgatttgaatctccagaatcacaggca
tctgccgaacagcctgaaatgtga

DBGET integrated database retrieval system