Homo sapiens (human): 115482686 Help Entry 115482686         CDS       T01001                                  Symbol H2AL3, H2A.L.3, H2AL1RP Name (RefSeq) H2A.L variant histone 3   KO K11251   histone H2A Organism hsa  Homo sapiens (human) Pathway hsa03082   ATP-dependent chromatin remodeling hsa04217   Necroptosis hsa04613   Neutrophil extracellular trap formation hsa05034   Alcoholism hsa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:hsa00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     115482686 (H2AL3)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     115482686 (H2AL3)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     115482686 (H2AL3)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     115482686 (H2AL3)   09165 Substance dependence    05034 Alcoholism     115482686 (H2AL3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hsa03036]     115482686 (H2AL3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     115482686 (H2AL3) Chromosome and associated proteins [BR:hsa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     115482686 (H2AL3) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115482686 (H2AL3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CDC27 Myc_N CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  115482686 NCBI-ProteinID:  NP_001382484 HGNC:  53960 Ensembl:  ENSG00000229674 LinkDB All DBs Position X:37994272..37994904 Genome browser AA seq 148 aa AA seqDB search MAGNKMFCRPRRQRLSHSRRAELQFPVSHLERCLRESQHARHLSSTTPVFLAGVLEYLTA NILEKVGKEVKNSCRLCITPEHVKRALQKDEQLRWILELEDDTHSQVEEMPQSEEEEEEE EEKEEEMVVLVVMGGRRRRRRRRRRKDS NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggctggaaacaaaatgttctgtaggcctaggagacaacgcctttcccattccagaaga gcagagctgcagtttcctgtcagccacttggaacgctgcctgcgagaaagtcagcatgcc cggcacctgagctcaaccacacctgttttcctggctggtgttctcgagtatctgacagcc aacatcctggaaaaggtgggcaaggaggtcaagaacagctgcaggctgtgcatcacccca gaacacgtgaagagggcactgcaaaaggatgagcagctcagatggatcttggagttggaa gatgacacccactctcaagtagaagaaatgccccaatctgaggaggaagaggaggaggag gaggagaaggaggaggagatggtggtgctggtggtgatggggggaaggaggaggaggagg agaagaaggaggaggaaggattcctga

DBGET integrated database retrieval system