KEGG   Homo sapiens (human): 115650
Entry
115650            CDS       T01001                                 

Gene name
TNFRSF13C, BAFF-R, BAFFR, BROMIX, CD268, CVID4, prolixin
Definition
(RefSeq) TNF receptor superfamily member 13C
  KO
K05151  tumor necrosis factor receptor superfamily member 13C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05166  Human T-cell leukemia virus 1 infection
hsa05340  Primary immunodeficiency
Disease
H00088  Common variable immunodeficiency
Drug target
Ianalumab: D12151
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    115650 (TNFRSF13C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    115650 (TNFRSF13C)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    115650 (TNFRSF13C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    115650 (TNFRSF13C)
  09163 Immune disease
   05340 Primary immunodeficiency
    115650 (TNFRSF13C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    115650 (TNFRSF13C)
   04090 CD molecules [BR:hsa04090]
    115650 (TNFRSF13C)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   115650 (TNFRSF13C)
CD molecules [BR:hsa04090]
 Proteins
  115650 (TNFRSF13C)
SSDB
Motif
Pfam: BaffR-Tall_bind SKG6 DUF4381 SIT DUF4079
Other DBs
NCBI-GeneID: 115650
NCBI-ProteinID: NP_443177
OMIM: 606269
HGNC: 17755
Ensembl: ENSG00000159958
Vega: OTTHUMG00000151271
Pharos: Q96RJ3(Tbio)
UniProt: Q96RJ3 Q5H8V1
LinkDB
Structure
PDB: 
1OQE 2HFG 1OSX

Position
22q13.2
AA seq 184 aa
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQ
ESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGD
KDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAG
PEQQ
NT seq 555 nt   +upstreamnt  +downstreamnt
atgaggcgagggccccggagcctgcggggcagggacgcgccagcccccacgccctgcgtc
ccggccgagtgcttcgacctgctggtccgccactgcgtggcctgcgggctcctgcgcacg
ccgcggccgaaaccggccggggccagcagccctgcgcccaggacggcgctgcagccgcag
gagtcggtgggcgcgggggccggcgaggcggcgctgcccctgcccgggctgctctttggc
gcccccgcgctgctgggcctggcactggtcctggcgctggtcctggtgggtctggtgagc
tggaggcggcgacagcggcggcttcgcggcgcgtcctccgcagaggcccccgacggagac
aaggacgccccagagcccctggacaaggtcatcattctgtctccgggaatctctgatgcc
acagctcctgcctggcctcctcctggggaagacccaggaaccaccccacctggccacagt
gtccctgtgccagccacagagctgggctccactgaactggtgaccaccaagacggccggc
cctgagcaacaatag

DBGET integrated database retrieval system