KEGG   Homo sapiens (human): 116028
Entry
116028            CDS       T01001                                 

Gene name
RMI2, BLAP18, C16orf75
Definition
(RefSeq) RecQ mediated genome instability 2
  KO
K15365  RecQ-mediated genome instability protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    116028 (RMI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    116028 (RMI2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Bloom's syndrome complex (BTR)
     116028 (RMI2)
   FA (Fanconi anemia) pathway
     116028 (RMI2)
SSDB
Motif
Pfam: RMI2
Other DBs
NCBI-GeneID: 116028
NCBI-ProteinID: NP_689521
OMIM: 612426
HGNC: 28349
Ensembl: ENSG00000175643
Vega: OTTHUMG00000129793
Pharos: Q96E14(Tbio)
UniProt: Q96E14
LinkDB
Structure
PDB: 
3MXN 3NBH 4DAY

Position
16p13.13
AA seq 147 aa
MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWM
QGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAV
KMTDLSDNPIHESMWELEVEDLHRNIP
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcggcggctgcggactcgttctcaggcggccccgcgggggtgcggcttccgaggtcg
ccgccactcaaggtgctggcggagcagctgcggcgcgacgcggagggcggcccgggcgcg
tggcggctgtcacgggcggcggcgggccgcgggccgctggacctggcggccgtgtggatg
cagggcagggtagtgatggcggaccgcggcgaggctcggctgagggacccgagcggggac
ttctcggtccgcggcctggagcgggtgccgcgcgggcggccctgtctagtcccaggaaag
tatgtgatggtgatgggagtggttcaggcctgcagccctgagccctgcctgcaggctgtg
aagatgacagacctttctgataatcccatccatgaaagtatgtgggaactggaggtagaa
gatttacacaggaatattccttag

DBGET integrated database retrieval system