KEGG   Homo sapiens (human): 118424
Entry
118424            CDS       T01001                                 
Symbol
UBE2J2, NCUBE-2, NCUBE2, PRO2121, UBC6
Name
(RefSeq) ubiquitin conjugating enzyme E2 J2
  KO
K04554  ubiquitin-conjugating enzyme E2 J2 [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    118424 (UBE2J2)
   04120 Ubiquitin mediated proteolysis
    118424 (UBE2J2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    118424 (UBE2J2)
   05022 Pathways of neurodegeneration - multiple diseases
    118424 (UBE2J2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    118424 (UBE2J2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     118424 (UBE2J2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   118424 (UBE2J2)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 118424
NCBI-ProteinID: NP_477515
OMIM: 619756
HGNC: 19268
Ensembl: ENSG00000160087
Pharos: Q8N2K1(Tbio)
UniProt: Q8N2K1 A0A024R075
Structure
LinkDB
Position
1:complement(1253912..1273854)
AA seq 259 aa
MSSTSSKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGY
YHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLS
FMVEKGPTLGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSR
PQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIV
GFAAFAYTVKYVLRSIAQE
NT seq 780 nt   +upstreamnt  +downstreamnt
atgagcagcaccagcagtaagagggctccgaccacggcaacccagaggctgaagcaggac
taccttcgcattaagaaagacccggtgccttacatctgtgccgagcccctcccttcgaat
attctcgagtggcactatgtcgtccgaggcccagagatgaccccttatgaaggtggctat
tatcatggaaaactaatttttcccagagaatttcctttcaaacctcccagtatctatatg
atcactcccaacgggaggtttaagtgcaacaccaggctgtgtctttctatcacggatttc
cacccggacacgtggaacccggcctggtctgtctccaccatcctgactgggctcctgagc
ttcatggtggagaagggccccaccctgggcagtatagagacgtcggacttcacgaaaaga
caactggcagtgcagagtttagcatttaatttgaaagataaagtcttttgtgaattattt
cctgaagtcgtggaggagattaaacaaaaacagaaagcacaagacgaactcagtagcaga
ccccagactctccccttgccagacgtggttccagacggggagacgcacctcgtccagaac
gggattcagctgctcaacgggcatgcgccgggggccgtcccaaacctcgcagggctccag
caggccaaccggcaccacggactcctgggtggcgccctggcgaacttgtttgtgatagtt
gggtttgcagcctttgcttacacggtcaagtacgtgctgaggagcatcgcgcaggagtga

DBGET integrated database retrieval system