KEGG   Homo sapiens (human): 1191
Entry
1191              CDS       T01001                                 
Symbol
CLU, AAG4, APO-J, APOJ, CLI, CLU1, CLU2, KUB1, NA1/NA2, SGP-2, SGP2, SP-40, TRPM-2, TRPM2
Name
(RefSeq) clusterin
  KO
K17252  clusterin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Network
nt06513  Complement cascade
  Element
N01505  Regulation of complement cascade, MAC inhibition
Drug target
Custirsen sodium: D09403
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    1191 (CLU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    1191 (CLU)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1191 (CLU)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  Others
   1191 (CLU)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   1191 (CLU)
SSDB
Motif
Pfam: Clusterin ApoLp-III SOAR RPW8 zf-C4pol
Other DBs
NCBI-GeneID: 1191
NCBI-ProteinID: NP_001822
OMIM: 185430
HGNC: 2095
Ensembl: ENSG00000120885
Pharos: P10909(Tbio)
UniProt: P10909
LinkDB
Position
8:complement(27596917..27614700)
AA seq 449 aa
MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLI
EKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQT
CMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHF
SRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNF
HAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKD
QCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLE
QLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVP
VEVSRKNPKFMETVAEKALQEYRKKHREE
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgatgaagactctgctgctgtttgtggggctgctgctgacctgggagagtgggcaggtc
ctgggggaccagacggtctcagacaatgagctccaggaaatgtccaatcagggaagtaag
tacgtcaataaggaaattcaaaatgctgtcaacggggtgaaacagataaagactctcata
gaaaaaacaaacgaagagcgcaagacactgctcagcaacctagaagaagccaagaagaag
aaagaggatgccctaaatgagaccagggaatcagagacaaagctgaaggagctcccagga
gtgtgcaatgagaccatgatggccctctgggaagagtgtaagccctgcctgaaacagacc
tgcatgaagttctacgcacgcgtctgcagaagtggctcaggcctggttggccgccagctt
gaggagttcctgaaccagagctcgcccttctacttctggatgaatggtgaccgcatcgac
tccctgctggagaacgaccggcagcagacgcacatgctggatgtcatgcaggaccacttc
agccgcgcgtccagcatcatagacgagctcttccaggacaggttcttcacccgggagccc
caggatacctaccactacctgcccttcagcctgccccaccggaggcctcacttcttcttt
cccaagtcccgcatcgtccgcagcttgatgcccttctctccgtacgagcccctgaacttc
cacgccatgttccagcccttccttgagatgatacacgaggctcagcaggccatggacatc
cacttccatagcccggccttccagcacccgccaacagaattcatacgagaaggcgacgat
gaccggactgtgtgccgggagatccgccacaactccacgggctgcctgcggatgaaggac
cagtgtgacaagtgccgggagatcttgtctgtggactgttccaccaacaacccctcccag
gctaagctgcggcgggagctcgacgaatccctccaggtcgctgagaggttgaccaggaaa
tacaacgagctgctaaagtcctaccagtggaagatgctcaacacctcctccttgctggag
cagctgaacgagcagtttaactgggtgtcccggctggcaaacctcacgcaaggcgaagac
cagtactatctgcgggtcaccacggtggcttcccacacttctgactcggacgttccttcc
ggtgtcactgaggtggtcgtgaagctctttgactctgatcccatcactgtgacggtccct
gtagaagtctccaggaagaaccctaaatttatggagaccgtggcggagaaagcgctgcag
gaataccgcaaaaagcaccgggaggagtga

DBGET integrated database retrieval system