KEGG   Homo sapiens (human): 1191
Entry
1191              CDS       T01001                                 

Gene name
CLU, AAG4, APO-J, APOJ, CLI, CLU1, CLU2, KUB1, NA1/NA2, SGP-2, SGP2, SP-40, TRPM-2, TRPM2
Definition
(RefSeq) clusterin
  KO
K17252  clusterin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Drug target
Custirsen sodium: D09403
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    1191 (CLU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    1191 (CLU)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1191 (CLU)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  Others
   1191 (CLU)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   1191 (CLU)
SSDB
Motif
Pfam: Clusterin ApoLp-III SOAR CREPT RPW8 T3SSipB zf-C4pol
Other DBs
NCBI-GeneID: 1191
NCBI-ProteinID: NP_001822
OMIM: 185430
HGNC: 2095
Ensembl: ENSG00000120885
Vega: OTTHUMG00000102114
Pharos: P10909(Tbio)
UniProt: P10909
LinkDB
Position
8p21.1
AA seq 449 aa
MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLI
EKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQT
CMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHF
SRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNF
HAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKD
QCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLE
QLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVP
VEVSRKNPKFMETVAEKALQEYRKKHREE
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgatgaagactctgctgctgtttgtggggctgctgctgacctgggagagtgggcaggtc
ctgggggaccagacggtctcagacaatgagctccaggaaatgtccaatcagggaagtaag
tacgtcaataaggaaattcaaaatgctgtcaacggggtgaaacagataaagactctcata
gaaaaaacaaacgaagagcgcaagacactgctcagcaacctagaagaagccaagaagaag
aaagaggatgccctaaatgagaccagggaatcagagacaaagctgaaggagctcccagga
gtgtgcaatgagaccatgatggccctctgggaagagtgtaagccctgcctgaaacagacc
tgcatgaagttctacgcacgcgtctgcagaagtggctcaggcctggttggccgccagctt
gaggagttcctgaaccagagctcgcccttctacttctggatgaatggtgaccgcatcgac
tccctgctggagaacgaccggcagcagacgcacatgctggatgtcatgcaggaccacttc
agccgcgcgtccagcatcatagacgagctcttccaggacaggttcttcacccgggagccc
caggatacctaccactacctgcccttcagcctgccccaccggaggcctcacttcttcttt
cccaagtcccgcatcgtccgcagcttgatgcccttctctccgtacgagcccctgaacttc
cacgccatgttccagcccttccttgagatgatacacgaggctcagcaggccatggacatc
cacttccatagcccggccttccagcacccgccaacagaattcatacgagaaggcgacgat
gaccggactgtgtgccgggagatccgccacaactccacgggctgcctgcggatgaaggac
cagtgtgacaagtgccgggagatcttgtctgtggactgttccaccaacaacccctcccag
gctaagctgcggcgggagctcgacgaatccctccaggtcgctgagaggttgaccaggaaa
tacaacgagctgctaaagtcctaccagtggaagatgctcaacacctcctccttgctggag
cagctgaacgagcagtttaactgggtgtcccggctggcaaacctcacgcaaggcgaagac
cagtactatctgcgggtcaccacggtggcttcccacacttctgactcggacgttccttcc
ggtgtcactgaggtggtcgtgaagctctttgactctgatcccatcactgtgacggtccct
gtagaagtctccaggaagaaccctaaatttatggagaccgtggcggagaaagcgctgcag
gaataccgcaaaaagcaccgggaggagtga

DBGET integrated database retrieval system