KEGG   Homo sapiens (human): 123264
Entry
123264            CDS       T01001                                 
Symbol
SLC51B, OSTB, OSTBETA, PBAM2
Name
(RefSeq) solute carrier family 51 subunit beta
  KO
K14361  organic solute transporter subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04976  Bile secretion
Disease
H01016  Primary bile acid malabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    123264 (SLC51B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    123264 (SLC51B)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC51: Transporter of steroid-derived molecules
   123264 (SLC51B)
SSDB
Motif
Pfam: OSTbeta DUF2140
Other DBs
NCBI-GeneID: 123264
NCBI-ProteinID: NP_849190
OMIM: 612085
HGNC: 29956
Ensembl: ENSG00000186198
Pharos: Q86UW2(Tbio)
UniProt: Q86UW2
LinkDB
Position
15:65045387..65053397
AA seq 128 aa
MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQ
ASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFL
PDVPETES
NT seq 387 nt   +upstreamnt  +downstreamnt
atggagcacagtgagggggctcccggagacccagccggtactgtggtaccccaggagctg
ctggaagagatgctttggttttttcgtgtggaagatgcatctccctggaatcattccatc
cttgccctggcagctgtggtggtcattataagcatggtcctcctgggaagaagcatccag
gcaagcagaaaagaaaagatgcagccaccagaaaaagaaactccagaagtcctgcatttg
gatgaggccaaggatcacaacagcctaaacaacctaagagaaactttgctctcagaaaag
ccaaacttggcccaggtggaacttgagttaaaagagagagatgtgctgtcagttttcctt
ccggatgtaccagaaactgagagctag

DBGET integrated database retrieval system