KEGG   Homo sapiens (human): 1235
Entry
1235              CDS       T01001                                 

Gene name
CCR6, BN-1, C-C_CKR-6, CC-CKR-6, CCR-6, CD196, CKR-L3, CKRL3, CMKBR6, DCR2, DRY6, GPR29, GPRCY4, STRL22
Definition
(RefSeq) C-C motif chemokine receptor 6
  KO
K04181  C-C chemokine receptor type 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01213  CCL20 to CCR6 signaling
N01214  HHV6A vCCL4a to CCR6 signaling
Disease
H01492  Systemic sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1235 (CCR6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1235 (CCR6)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    1235 (CCR6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1235 (CCR6)
   04050 Cytokine receptors [BR:hsa04050]
    1235 (CCR6)
   04090 CD molecules [BR:hsa04090]
    1235 (CCR6)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    1235 (CCR6)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1235 (CCR6)
CD molecules [BR:hsa04090]
 Proteins
  1235 (CCR6)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 1235
NCBI-ProteinID: NP_004358
OMIM: 601835
HGNC: 1607
Ensembl: ENSG00000112486
Vega: OTTHUMG00000016015
Pharos: P51684(Tbio)
UniProt: P51684
LinkDB
Position
6q27
AA seq 374 aa
MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRLFVPIAYSLICVFG
LLGNILVVITFAFYKKARSMTDVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKL
LKGIYAINFNCGMLLLTCISMDRYIAIVQATKSFRLRSRTLPRSKIICLVVWGLSVIISS
STFVFNQKYNTQGSDVCEPKYQTVSEPIRWKLLMLGLELLFGFFIPLMFMIFCYTFIVKT
LVQAQNSKRHKAIRVIIAVVLVFLACQIPHNMVLLVTAANLGKMNRSCQSEKLIGYTKTV
TEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQT
SETADNDNASSFTM
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgagcggggaatcaatgaatttcagcgatgttttcgactccagtgaagattattttgtg
tcagtcaatacttcatattactcagttgattctgagatgttactgtgctccttgcaggag
gtcaggcagttctccaggctatttgtaccgattgcctactccttgatctgtgtctttggc
ctcctggggaatattctggtggtgatcacctttgctttttataagaaggccaggtctatg
acagacgtctatctcttgaacatggccattgcagacatcctctttgttcttactctccca
ttctgggcagtgagtcatgccaccggtgcgtgggttttcagcaatgccacgtgcaagttg
ctaaaaggcatctatgccatcaactttaactgcgggatgctgctcctgacttgcattagc
atggaccggtacatcgccattgtacaggcgactaagtcattccggctccgatccagaaca
ctaccgcgcagcaaaatcatctgccttgttgtgtgggggctgtcagtcatcatctccagc
tcaacttttgtcttcaaccaaaaatacaacacccaaggcagcgatgtctgtgaacccaag
taccagactgtctcggagcccatcaggtggaagctgctgatgttggggcttgagctactc
tttggtttctttatccctttgatgttcatgatattttgttacacgttcattgtcaaaacc
ttggtgcaagctcagaattctaaaaggcacaaagccatccgtgtaatcatagctgtggtg
cttgtgtttctggcttgtcagattcctcataacatggtcctgcttgtgacggctgcaaat
ttgggtaaaatgaaccgatcctgccagagcgaaaagctaattggctatacgaaaactgtc
acagaagtcctggctttcctgcactgctgcctgaaccctgtgctctacgcttttattggg
cagaagttcagaaactactttctgaagatcttgaaggacctgtggtgtgtgagaaggaag
tacaagtcctcaggcttctcctgtgccgggaggtactcagaaaacatttctcggcagacc
agtgagaccgcagataacgacaatgcgtcgtccttcactatgtga

DBGET integrated database retrieval system