KEGG   Homo sapiens (human): 126374
Entry
126374            CDS       T01001                                 

Gene name
WTIP
Definition
(RefSeq) WT1 interacting protein
  KO
K16682  LIM domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    126374 (WTIP)
   04392 Hippo signaling pathway - multiple species
    126374 (WTIP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    126374 (WTIP)
   03036 Chromosome and associated proteins [BR:hsa03036]
    126374 (WTIP)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     126374 (WTIP)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     126374 (WTIP)
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 126374
NCBI-ProteinID: NP_001073905
OMIM: 614790
HGNC: 20964
Ensembl: ENSG00000142279
Vega: OTTHUMG00000182099
Pharos: A6NIX2(Tbio)
UniProt: A6NIX2
LinkDB
Position
19q13.11
AA seq 430 aa
MQRSRAGADEAALLLAGLALRELEPGCGSPGRGRRGPRPGPGDEAAPALGRRGKGSGGPE
AGADGLSRGERGPRRAAVPELSAQPAGSPRASLAGSDGGGGGGSARSSGISLGYDQRHGS
PRSGRSDPRPGPGPPSVGSARSSVSSLGSRGSAGAYADFLPPGACPAPARSPEPAGPAPF
PLPALPLPPGREGGPSAAERRLEALTRELERALEARTARDYFGICIKCGLGIYGAQQACQ
AMGSLYHTDCFTCDSCGRRLRGKAFYNVGEKVYCQEDFLYSGFQQTADKCSVCGHLIMEM
ILQALGKSYHPGCFRCSVCNECLDGVPFTVDVENNIYCVRDYHTVFAPKCASCARPILPA
QGCETTIRVVSMDRDYHVACYHCEDCGLQLSGEEGRRCYPLAGHLLCRRCHLRRLQPGPL
PSPTVHVTEL
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgcagcgctccagggcgggcgcggacgaggcggccctactcctggccgggctggccctg
cgggagctggagcccgggtgcggctctcccggtcgggggcggcgggggccgcggcctggg
cctggagacgaggcggcgcccgcgctgggccgcagagggaagggcagcggcggccccgag
gccggggcggacggactgagccgcggggagcggggtccccggcgcgcggcggttccggag
ctcagcgcgcagcctgcgggcagcccacgggccagcctggcggggtccgacggcggcggc
ggtggcggcagcgcccgatccagcggcatcagcctgggctacgaccagcgccacggcagc
ccgcgctccggtcgctcggacccgcgtcccggtcccgggccgccttcggtgggcagcgcc
cgctccagcgtttccagcctcggctcccggggctcggccggcgcctacgctgacttcctc
ccgcccggcgcctgccccgcgcccgctcgctccccggagcctgcggggccggctcccttc
ccgctgcctgcactcccgctgccccctggccgggagggcggcccaagcgcggccgagcgg
cggctggaggcgctcacccgggagctggagcgggcgctcgaggcgcgcacggcgcgggac
tacttcggcatttgcatcaagtgtgggcttggcatctacggagcccagcaggcgtgccag
gcaatggggagtctttatcacactgactgcttcacctgcgactcgtgtgggagacgactc
cgtgggaaggcgttctacaacgtgggtgagaaagtgtactgccaggaggacttcctgtac
tccgggttccagcagacggccgacaaatgcagcgtgtgtggacatctcatcatggaaatg
atcctgcaggccctgggcaagtcctaccacccaggctgcttccggtgctccgtgtgcaat
gagtgcctggacggggttcccttcaccgtggacgtggagaacaacatctactgcgtgcga
gactatcacacggtttttgcaccaaaatgcgcctcctgtgcccgtcctatcctccctgca
cagggctgcgagacaaccatccgtgtggtgtccatggacagagactaccacgtggcatgt
taccactgtgaggactgcgggctgcagctgagcggggaggagggacgccgttgctatccc
ctggcgggccacctactgtgtcgtcgttgccacctgcggcgcctccaacctgggcctctt
ccctcacccactgtgcacgtcactgagctctga

KEGG   Homo sapiens (human): 84962
Entry
84962             CDS       T01001                                 

Gene name
AJUBA, JUB
Definition
(RefSeq) ajuba LIM protein
  KO
K16682  LIM domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    84962 (AJUBA)
   04392 Hippo signaling pathway - multiple species
    84962 (AJUBA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    84962 (AJUBA)
   03036 Chromosome and associated proteins [BR:hsa03036]
    84962 (AJUBA)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     84962 (AJUBA)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     84962 (AJUBA)
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 84962
NCBI-ProteinID: NP_116265
OMIM: 609066
HGNC: 20250
Ensembl: ENSG00000129474
Vega: OTTHUMG00000028711
Pharos: Q96IF1(Tbio)
UniProt: Q96IF1
LinkDB
Position
14q11.2
AA seq 538 aa
MERLGEKASRLLEKFGRRKGESSRSGSDGTPGPGKGRLSGLGGPRKSGPRGATGGPGDEP
LEPAREQGSLDAERNQRGSFEAPRYEGSFPAGPPPTRALPLPQSLPPDFRLEPTAPALSP
RSSFASSSASDASKPSSPRGSLLLDGAGAGGAGGSRPCSNRTSGISMGYDQRHGSPLPAG
PCLFGPPLAGAPAGYSPGGVPSAYPELHAALDRLYAQRPAGFGCQESRHSYPPALGSPGA
LAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDELTALLRLTVGTGGREAGARGE
PSGIEPSGLEEPPGPFVPEAARARMREPEAREDYFGTCIKCNKGIYGQSNACQALDSLYH
TQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLILEKILQAMGK
SYHPGCFRCIVCNKCLDGIPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGCEDIV
RVISMDRDYHFECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLNARQPPANYI
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggagcggttaggagagaaagccagtcgcctgctggagaagttcggccgcagaaagggt
gaatctagccggtctgggtctgacgggacccccgggccgggcaaggggcgcctaagtggg
ttggggggacctaggaagtcagggccccgaggagctactgggggacctggggatgagccg
ttggagccggcccgggagcaaggttccctggacgctgagcgaaatcagcgcggctccttt
gaggcgccgcgctacgaaggctcttttcccgcggggccgccgcccacccgggccttgcct
ctacctcagtcgttgccccccgattttcggctggagcccacggccccggccctcagcccc
cgctctagcttcgccagtagctcggccagcgacgcgagcaagccgtccagcccccggggc
agcctgctgctggacggggcgggggctggcggagctggaggtagccggccctgcagcaat
cgcaccagcggcatcagcatgggctacgaccagcgccacgggagccccttgccagcgggg
ccgtgcctgtttggcccacccctggccggagcaccggcaggctattctcccggaggggtc
ccgtccgcctacccggagctccacgccgccctggaccgattgtacgctcagcggcccgcg
gggttcggctgccaggaaagccgccactcgtatcccccggccctgggcagccctggagct
ctagccggggccggagtgggagcggcggggcccttggagagacggggggcgcaacccgga
cgacactctgtgaccggctacggggactgcgccgtgggcgcccggtaccaggacgagcta
acagctttgcttcgcctgacggtgggcaccggtgggcgagaagccggagcccgcggagaa
ccctcggggattgagccgtcgggtctggaggagccaccaggtcctttcgttccggaggcc
gcccgggcccggatgcgggagccagaggccagggaggactacttcggcacctgtatcaag
tgcaacaaaggcatctatgggcagagcaatgcctgccaggccctggacagcctctaccac
acccagtgctttgtttgctgctcttgtgggcgaactttgcgttgcaaggctttctacagt
gtcaatggctctgtgtactgtgaggaagattatctgttttcagggtttcaggaggcagct
gagaaatgctgtgtctgtggtcacttgattttggagaagatcctacaagcaatggggaag
tcctatcatccaggctgtttccgatgcattgtttgcaacaagtgcctggatggcatcccc
ttcacagtggacttctccaaccaagtatactgtgtcaccgactaccacaaaaattatgct
cctaagtgtgcagcctgtggccaacccatcctcccctctgagggctgtgaggacatcgtg
agggtgatatccatggaccgggattatcactttgagtgctaccactgtgaggactgccgg
atgcagctgagtgatgaggaaggctgctgctgtttccctctggatgggcacttgctctgc
catggttgccacatgcagcggctcaatgcccgacaaccccctgccaactatatctga

KEGG   Homo sapiens (human): 8994
Entry
8994              CDS       T01001                                 

Gene name
LIMD1
Definition
(RefSeq) LIM domain containing 1
  KO
K16682  LIM domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    8994 (LIMD1)
   04392 Hippo signaling pathway - multiple species
    8994 (LIMD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    8994 (LIMD1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8994 (LIMD1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     8994 (LIMD1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     8994 (LIMD1)
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 8994
NCBI-ProteinID: NP_055055
OMIM: 604543
HGNC: 6612
Ensembl: ENSG00000144791
Vega: OTTHUMG00000133453
Pharos: Q9UGP4(Tbio)
UniProt: Q9UGP4
LinkDB
Position
3p21.31
AA seq 676 aa
MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQQ
QQQLLQEETLPRGSRGPVNGGGRLGPQARWEVVGSKLTVDGAAKPPLAASTGAPGAVTTL
AAGQPPYPPQEQRSRPYLHGTRHGSQDCGSRESLATSEMSAFHQPGPCEDPSCLTHGDYY
DNLSLASPKWGDKPGVSPSIGLSVGSGWPSSPGSDPPLPKPCGDHPLNHRQLSLSSSRSS
EGSLGGQNSGIGGRSSEKPTGLWSTASSQRVSPGLPSPNLENGAPAVGPVQPRTPSVSAP
LALSCPRQGGLPRSNSGLGGEVSGVMSKPNVDPQPWFQDGPKSYLSSSAPSSSPAGLDGS
QQGAVPGLGPKPGCTDLGTGPKLSPTSLVHPVMSTLPELSCKEGPLGWSSDGSLGSVLLD
SPSSPRVRLPCQPLVPGPELRPSAAELKLEALTQRLEREMDAHPKADYFGACVKCSKGVF
GAGQACQAMGNLYHDTCFTCAACSRKLRGKAFYFVNGKVFCEEDFLYSGFQQSADRCFLC
GHLIMDMILQALGKSYHPGCFRCVICNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAAC
GLPILPPEGSDETIRVVSMDRDYHVECYHCEDCGLELNDEDGHRCYPLEDHLFCHSCHVK
RLEKRPSSTALHQHHF
NT seq 2031 nt   +upstreamnt  +downstreamnt
atggataagtatgacgacctgggcctggaggccagtaaattcatcgaggacctgaacatg
tatgaggcctctaaggatgggctcttccgagtggacaagggtgcaggcaacaaccccgag
tttgaggaaactcgcagggtgttcgccaccaagatggccaaaatccacctccagcagcag
cagcagcagctcctgcaggaggagactctgcccagggggagtagaggccctgtcaatgga
gggggccgcctgggcccacaggcccgttgggaagttgtgggcagcaagctgactgtggat
ggtgctgccaagcctcctcttgctgcctcgacaggggcacctggggcagtcaccaccctc
gctgctgggcagcccccgtacccaccgcaggagcagagatccaggccatacctgcatggc
acgaggcatggcagccaggactgtggttccagggagagcctggcgacttctgagatgtct
gctttccaccagccaggcccctgtgaggatccttcctgcctcactcatggagactattat
gacaacctctccttggcaagcccaaagtggggtgacaaaccaggagtgtcccccagcatc
ggcctgagtgtagggagtgggtggcctagctccccggggagtgacccaccactgcccaaa
ccctgcggggaccatcccctaaatcaccgacagctctccctgagctccagcaggtcttct
gagggtagcctcggtggtcagaatagtggcattggtggccgcagcagcgagaagccaaca
ggcctttggtccactgcctcctcccagcgggtgagccctggcctgccttccccaaacttg
gagaacggagcaccagctgtggggcctgttcagcccaggaccccttctgtgtcagcaccc
ttggccctgagctgccccaggcaaggaggtcttccaagatcaaactcggggctggggggt
gaggtttcaggtgtgatgtccaaacccaatgtggacccccaaccctggttccaggatggg
cccaaatcttacctttccagttctgccccgtcatcctcgccagctggtctggacggttca
cagcagggtgcggtccctgggctggggccgaagcctggctgcacagaccttggcactggt
cccaagctcagccccaccagtcttgtccatccagtgatgtccaccctgcctgagttatct
tgtaaagagggtcccctgggctggtcttctgatggtagcctgggatctgtgctcctggac
agccccagctcccctagggtaaggctgccctgccagcccctcgtcccaggtcctgagctg
agaccctctgctgctgagttgaaattagaagccctcacccaacgtctggagcgagagatg
gatgctcacccgaaggctgattactttggagcctgtgtgaaatgcagcaaaggggtgttt
ggggctggccaggcctgtcaggccatggggaacctctaccatgacacatgcttcacctgt
gcagcttgcagccggaagctgagaggaaaagccttttattttgtcaacggcaaagtgttt
tgtgaagaagacttcctgtactctggtttccagcagtcggctgacaggtgttttctttgt
ggacatctgatcatggacatgatcctgcaagccctggggaagtcctaccaccccggctgt
ttccgctgtgtcatctgtaatgagtgtttggatggggtgcccttcaccgtggactcagag
aacaagatctactgtgtccgagattaccacaaggtgctggcccccaagtgtgcagcctgt
gggcttcccatccttccacctgagggctcagatgagaccatccgtgtcgtgtccatggac
agagactaccacgtggagtgttaccactgcgaggactgtggtctggagctcaatgatgaa
gatggccaccgctgttatccgctggaggaccacctgttctgtcactcctgccacgtgaag
aggctggagaagagaccctcatctacagcccttcaccagcaccacttctag

DBGET integrated database retrieval system