KEGG   Homo sapiens (human): 128178
Entry
128178            CDS       T01001                                 
Symbol
EDARADD, ECTD11A, ECTD11B, ED3, EDA3
Name
(RefSeq) EDAR associated death domain
  KO
K23324  ectodysplasin-A receptor-associated adapter protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
Disease
H00651  Hypohidrotic ectodermal dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    128178 (EDARADD)
SSDB
Motif
Pfam: Death
Other DBs
NCBI-GeneID: 128178
NCBI-ProteinID: NP_665860
OMIM: 606603
HGNC: 14341
Ensembl: ENSG00000186197
Vega: OTTHUMG00000039954
Pharos: Q8WWZ3(Tbio)
UniProt: Q8WWZ3
LinkDB
Position
1:236394286..236484930
AA seq 215 aa
MGLRTTKQMGRGTKAPGHQEDHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTI
TLNCPRNSDMKNQGEENGFPDSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQD
LLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLM
ELCRLYHRADVEKVLRRWVDEEWPKRERGDPSRHF
NT seq 648 nt   +upstreamnt  +downstreamnt
atgggcctcaggacgactaaacagatggggagaggcactaaagctcctggtcaccaagag
gatcatatggtaaaggaaccagtggaagacacagaccctagcactttatcctttaatatg
tcagacaaatatcccattcaagatacggaactccctaaagctgaagaatgtgatacaatt
actttgaactgcccacgaaattcagatatgaaaaatcagggagaagaaaatggctttcca
gatagcactggagatcctcttccagagatcagcaaggacaactcctgcaaagaaaactgt
acttgttcctcctgcttgctccgggcccccaccataagtgacttgctcaatgatcaggac
ttactagacgtgatcaggataaagctggatccgtgtcacccaacggtgaaaaactggagg
aattttgcaagcaaatgggggatgtcctatgacgaattgtgcttcctggagcagaggcca
cagagccccaccttggagttcttgctccggaacagtcagaggacggtgggccagctgatg
gagctctgcaggctctaccacagggccgacgtggagaaggttctgcgcaggtgggtggac
gaggagtggcccaagcgggagcgtggagacccctccaggcacttctag

DBGET integrated database retrieval system