KEGG   Homo sapiens (human): 132014
Entry
132014            CDS       T01001                                 
Symbol
IL17RE
Name
(RefSeq) interleukin 17 receptor E
  KO
K05168  interleukin 17 receptor E
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    132014 (IL17RE)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    132014 (IL17RE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    132014 (IL17RE)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL17 receptor family
   132014 (IL17RE)
SSDB
Motif
Pfam: IL17_R_N SEFIR Antimicrobial10
Other DBs
NCBI-GeneID: 132014
NCBI-ProteinID: NP_705613
OMIM: 614995
HGNC: 18439
Ensembl: ENSG00000163701
Pharos: Q8NFR9(Tdark)
UniProt: Q8NFR9
LinkDB
Position
3:9902093..9916402
AA seq 667 aa
MGSSRLAALLLPLLLIVIDLSDSAGIGFRHLPHWNTRCPLASHTDDSFTGSSAYIPCRTW
WALFSTKPWCVRVWHCSRCLCQHLLSGGSGLQRGLFHLLVQKSKKSSTFKFYRRHKMPAP
AQRKLLPRRHLSEKSHHISIPSPDISHKGLRSKRTQPSDPETWESLPRLDSQRHGGPEFS
FDLLPEARAIRVTISSGPEVSVRLCHQWALECEELSSPYDVQKIVSGGHTVELPYEFLLP
CLCIEASYLQEDTVRRKKCPFQSWPEAYGSDFWKSVHFTDYSQHTQMVMALTLRCPLKLE
AALCQRHDWHTLCKDLPNATARESDGWYVLEKVDLHPQLCFKFSFGNSSHVECPHQTGSL
TSWNVSMDTQAQQLILHFSSRMHATFSAAWSLPGLGQDTLVPPVYTVSQARGSSPVSLDL
IIPFLRPGCCVLVWRSDVQFAWKHLLCPDVSYRHLGLLILALLALLTLLGVVLALTCRRP
QSGPGPARPVLLLHAADSEAQRRLVGALAELLRAALGGGRDVIVDLWEGRHVARVGPLPW
LWAARTRVAREQGTVLLLWSGADLRPVSGPDPRAAPLLALLHAAPRPLLLLAYFSRLCAK
GDIPPPLRALPRYRLLRDLPRLLRALDARPFAEATSWGRLGARQRRQSRLELCSRLEREA
ARLADLG
NT seq 2004 nt   +upstreamnt  +downstreamnt
atggggagctccagactggcagccctgctcctgcctctcctcctcatagtcatcgacctc
tctgactctgctgggattggctttcgccacctgccccactggaacacccgctgtcctctg
gcctcccacacggatgacagtttcactggaagttctgcctatatcccttgccgcacctgg
tgggccctcttctccacaaagccttggtgtgtgcgagtctggcactgttcccgctgtttg
tgccagcatctgctgtcaggtggctcaggtcttcaacggggcctcttccacctcctggtg
cagaaatccaaaaagtcttccacattcaagttctataggagacacaagatgccagcacct
gctcagaggaagctgctgcctcgtcgtcacctgtctgagaagagccatcacatttccatc
ccctccccagacatctcccacaagggacttcgctctaaaaggacccaaccttcggatcca
gagacatgggaaagtcttcccagattggactcacaaaggcatggaggacccgagttctcc
tttgatttgctgcctgaggcccgggctattcgggtgaccatatcttcaggccctgaggtc
agcgtgcgtctttgtcaccagtgggcactggagtgtgaagagctgagcagtccctatgat
gtccagaaaattgtgtctgggggccacactgtagagctgccttatgaattccttctgccc
tgtctgtgcatagaggcatcctacctgcaagaggacactgtgaggcgcaaaaaatgtccc
ttccagagctggccagaagcctatggctcggacttctggaagtcagtgcacttcactgac
tacagccagcacactcagatggtcatggccctgacactccgctgcccactgaagctggaa
gctgccctctgccagaggcacgactggcataccctttgcaaagacctcccgaatgccaca
gctcgagagtcagatgggtggtatgttttggagaaggtggacctgcacccccagctctgc
ttcaagttctcttttggaaacagcagccatgttgaatgcccccaccagactgggtctctc
acatcctggaatgtaagcatggatacccaagcccagcagctgattcttcacttctcctca
agaatgcatgccaccttcagtgctgcctggagcctcccaggcttggggcaggacactttg
gtgccccccgtgtacactgtcagccaggcccggggctcaagcccagtgtcactagacctc
atcattcccttcctgaggccagggtgctgtgtcctggtgtggcggtcagatgtccagttt
gcctggaagcacctcttgtgtccggatgtctcttacagacacctggggctcttgatcctg
gcactgctggccctcctcaccctactgggtgttgttctggccctcacctgccggcgccca
cagtcaggcccgggcccagcgcggccagtgctcctcctgcacgcggcggactcggaggcg
cagcggcgcctggtgggagcgctggctgaactgctacgggcagcgctgggcggcgggcgc
gacgtgatcgtggacctgtgggaggggaggcacgtggcgcgcgtgggcccgctgccgtgg
ctctgggcggcgcggacgcgcgtagcgcgggagcagggcactgtgctgctgctgtggagc
ggcgccgaccttcgcccggtcagcggccccgacccccgcgccgcgcccctgctcgccctg
ctccacgctgccccgcgcccgctgctgctgctcgcttacttcagtcgcctctgcgccaag
ggcgacatccccccgccgctgcgcgccctgccgcgctaccgcctgctgcgcgacctgccg
cgtctgctgcgggcgctggacgcgcggcctttcgcagaggccaccagctggggccgcctt
ggggcgcggcagcgcaggcagagccgcctagagctgtgcagccggctcgaacgagaggcc
gcccgacttgcagacctaggttga

DBGET integrated database retrieval system