KEGG   Homo sapiens (human): 1325
Entry
1325              CDS       T01001                                 
Symbol
CORT, CST-14, CST-17, CST-29, SST2
Name
(RefSeq) cortistatin
  KO
K05238  cortistatin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1325 (CORT)
SSDB
Motif
Pfam: Somatostatin
Other DBs
NCBI-GeneID: 1325
NCBI-ProteinID: NP_001293
OMIM: 602784
HGNC: 2257
Ensembl: ENSG00000241563
Pharos: O00230(Tbio)
CPD: C16023 C16024
UniProt: O00230 Q8IUV6
Structure
LinkDB
Position
1:10450031..10451998
AA seq 105 aa
MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQA
SAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK
NT seq 318 nt   +upstreamnt  +downstreamnt
atgccattgtcccccggcctcctgctgctgctgctctccggggccacggccaccgctgcc
ctgcccctggagggtggccccaccggccgagacagcgagcatatgcaggaagcggcagga
ataaggaaaagcagcctcctgactttcctcgcttggtggtttgagtggacctcccaggcc
agtgccgggcccctcataggagaggaagcccgggaggtggccaggcggcaggaaggcgca
cccccccagcaatctgcgcgccgggacagaatgccctgcaggaacttcttctggaagacc
ttctcctcctgcaaataa

DBGET integrated database retrieval system