Homo sapiens (human): 1325 Help Entry 1325              CDS       T01001                                  Symbol CORT, CST-14, CST-17, CST-29, SST2 Name (RefSeq) cortistatin   KO K05238   cortistatin Organism hsa  Homo sapiens (human) Pathway hsa04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     1325 (CORT)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hsa04052]     1325 (CORT) Cytokines and neuropeptides [BR:hsa04052]  Neuropeptides   Neuropeptides (GPCR binding)    1325 (CORT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Somatostatin Motif Other DBs NCBI-GeneID:  1325 NCBI-ProteinID:  NP_001293 OMIM:  602784 HGNC:  2257 Ensembl:  ENSG00000241563 CPD:  C16023 C16024 UniProt:  O00230 Q8IUV6 Structure PDB LinkDB All DBs Position 1:10450031..10451998 Genome browser AA seq 105 aa AA seqDB search MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQA SAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgccattgtcccccggcctcctgctgctgctgctctccggggccacggccaccgctgcc ctgcccctggagggtggccccaccggccgagacagcgagcatatgcaggaagcggcagga ataaggaaaagcagcctcctgactttcctcgcttggtggtttgagtggacctcccaggcc agtgccgggcccctcataggagaggaagcccgggaggtggccaggcggcaggaaggcgca cccccccagcaatctgcgcgccgggacagaatgccctgcaggaacttcttctggaagacc ttctcctcctgcaaataa

Homo sapiens (human): 6750 Help Entry 6750              CDS       T01001                                  Symbol SST, SMST, SST1 Name (RefSeq) somatostatin   KO K05237   somatostatin Organism hsa  Homo sapiens (human) Pathway hsa04024   cAMP signaling pathway hsa04080   Neuroactive ligand-receptor interaction hsa04935   Growth hormone synthesis, secretion and action hsa04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     6750 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     6750 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     6750 (SST)   09154 Digestive system    04971 Gastric acid secretion     6750 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hsa04052]     6750 (SST) Cytokines and neuropeptides [BR:hsa04052]  Neuropeptides   Neuropeptides (GPCR binding)    6750 (SST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  6750 NCBI-ProteinID:  NP_001039 OMIM:  182450 HGNC:  11329 Ensembl:  ENSG00000157005 CPD:  C16021 C16022 UniProt:  P61278 Structure PDB LinkDB All DBs Position 3:complement(187668912..187670394) Genome browser AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggctgcgctgtccatcgtcctggccctgggc tgtgtcaccggcgctccctcggaccccagactccgtcagtttctgcagaagtccctggct gctgccgcggggaagcaggaactggccaagtacttcttggcagagctgctgtctgaaccc aaccagacggagaatgatgccctggaacctgaagatctgtcccaggctgctgagcaggat gaaatgaggcttgagctgcagagatctgctaactcaaacccggctatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttag

DBGET integrated database retrieval system