KEGG   Homo sapiens (human): 133
Entry
133               CDS       T01001                                 
Symbol
ADM, AM, PAMP
Name
(RefSeq) adrenomedullin
  KO
K12333  adrenomedullin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    133 (ADM)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    133 (ADM)
SSDB
Motif
Pfam: Calc_CGRP_IAPP Fibrinogen_C
Other DBs
NCBI-GeneID: 133
NCBI-ProteinID: NP_001115
OMIM: 103275
HGNC: 259
Ensembl: ENSG00000148926
Vega: OTTHUMG00000165907
Pharos: P35318(Tbio)
CPD: C16127 C18198
UniProt: P35318
Structure
LinkDB
Position
11:10305073..10307397
AA seq 185 aa
MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVK
AGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKL
AHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGS
APHFL
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaagctggtttccgtcgccctgatgtacctgggttcgctcgccttcctaggcgctgac
accgctcggttggatgtcgcgtcggagtttcgaaagaagtggaataagtgggctctgagt
cgtgggaagagggaactgcggatgtccagcagctaccccaccgggctcgctgacgtgaag
gccgggcctgcccagacccttattcggccccaggacatgaagggtgcctctcgaagcccc
gaagacagcagtccggatgccgcccgcatccgagtcaagcgctaccgccagagcatgaac
aacttccagggcctccggagctttggctgccgcttcgggacgtgcacggtgcagaagctg
gcacaccagatctaccagttcacagataaggacaaggacaacgtcgcccccaggagcaag
atcagcccccagggctacggccgccggcgccggcgctccctgcccgaggccggcccgggt
cggactctggtgtcttctaagccacaagcacacggggctccagcccccccgagtggaagt
gctccccactttctttag

KEGG   Homo sapiens (human): 79924
Entry
79924             CDS       T01001                                 
Symbol
ADM2, AM2, dJ579N16.4
Name
(RefSeq) adrenomedullin 2
  KO
K25343  adrenomedullin-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    79924 (ADM2)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    79924 (ADM2)
SSDB
Motif
Pfam: Calc_CGRP_IAPP
Other DBs
NCBI-GeneID: 79924
NCBI-ProteinID: NP_001240774
OMIM: 608682
HGNC: 28898
Ensembl: ENSG00000128165
Vega: OTTHUMG00000150202
Pharos: Q7Z4H4(Tbio)
CPD: C16128
UniProt: Q7Z4H4
Structure
LinkDB
Position
22:50481543..50486437
AA seq 148 aa
MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVW
KLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNL
SHRLWQLMGPAGRQDSAPVDPSSPHSYG
NT seq 447 nt   +upstreamnt  +downstreamnt
atggcccggatcccgacggccgccctgggttgcatcagcctcctctgcctgcagctccct
ggctcgctgtcccgcagcctgggcggggacccgcgacccgtcaaacccagggagccccca
gcccggagcccttccagcagcctgcagcccaggcaccccgcaccccgacctgtggtctgg
aagcttcaccgggccctccaggcacagaggggtgccggcctggcccctgttatgggtcag
cctctccgggatggtggccgccaacactcgggcccccgaagacactcgggcccccgcagg
acccaagcccagctcctgcgagtgggctgtgtgctgggcacctgccaggtgcagaatctc
agccaccgcctgtggcaactcatgggaccggccggccggcaggactcagctcctgtggac
cccagcagcccccacagctatggctga

DBGET integrated database retrieval system