KEGG   Homo sapiens (human): 133022
Entry
133022            CDS       T01001                                 
Symbol
TRAM1L1
Name
(RefSeq) translocation associated membrane protein 1 like 1
  KO
K14010  translocating chain-associated membrane protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    133022 (TRAM1L1)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Other DBs
NCBI-GeneID: 133022
NCBI-ProteinID: NP_689615
OMIM: 617505
HGNC: 28371
Ensembl: ENSG00000174599
Vega: OTTHUMG00000132956
Pharos: Q8N609(Tdark)
UniProt: Q8N609
LinkDB
Position
4:complement(117083554..117085576)
AA seq 369 aa
MGLRKKSTKNPPVLSQEFILQNHADIVSCVGMFFLLGLVFEGTAEASIVFLTLQHSVAVP
AAEEQATGSKSLYYYGVKDLATVFFYMLVAIIIHATIQEYVLDKINKRMQFTKAKQNKFN
ESGQFSVFYFFSCIWGTFILISENCLSDPTLIWKARPHSMMTFQMKFFYISQLAYWFHAF
PELYFQKTKKQDIPRQLVYIGLHLFHITGAYLLYLNHLGLLLLVLHYFVELLSHMCGLFY
FSDEKYQKGISLWAIVFILGRLVTLIVSVLTVGFHLAGSQNRNPDALTGNVNVLAAKIAV
LSSSCTIQAYVTWNLITLWLQRWVEDSNIQASCMKKKRSRSSKKRTENGVGVETSNRVDC
PPKRKEKSS
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggggctccgtaagaagagcaccaagaacccccccgttctcagccaggaattcatcctg
cagaatcatgcggacatcgtctcctgcgtggggatgttcttcctgctggggcttgtgttc
gagggaacagcagaagcatccatcgtgtttctcactcttcagcacagtgttgctgtccct
gcagcagaggaacaagccacgggctcaaagtccctctattattatggtgtcaaagatttg
gccacggttttcttctacatgctggtggcaatcattattcatgccacaattcaggaatat
gtgttggataaaattaacaagagaatgcagttcaccaaagcgaaacaaaacaagtttaac
gagtctggtcagtttagtgtgttctactttttttcttgtatttggggcacattcatttta
atctctgaaaactgcctgtcagacccaactcttatatggaaggctcgtccccatagcatg
atgacatttcaaatgaagtttttctacatatcccagttggcttactggtttcatgctttt
cctgaactctacttccagaaaaccaaaaaacaagacatccctcgtcaacttgtctacatt
ggtcttcacctcttccacattactggagcttatctcttgtacttgaatcatttgggactt
cttcttttggtactgcattattttgttgaattactttcccacatgtgcggcctgttttac
tttagtgatgaaaagtaccagaaaggcatatctctgtgggccattgtgtttatcttgggt
agacttgtgactttaattgtttccgtactcactgttgggtttcacctggctggatcgcag
aatcggaatcctgatgcccttactggaaatgtaaatgtgttggcagctaaaattgctgtt
ctgtcgtccagttgcacgatccaagcctacgtaacatggaacttaattactctctggctt
cagaggtgggtagaagattctaatattcaggcctcatgtatgaaaaagaaacggtcgaga
tcttctaaaaaaagaacagaaaacggagtgggagtggaaacttcaaatagagtagactgt
ccgccaaagaggaaagagaaatcttcataa

KEGG   Homo sapiens (human): 23471
Entry
23471             CDS       T01001                                 
Symbol
TRAM1, PNAS8, TRAM, TRAMP
Name
(RefSeq) translocation associated membrane protein 1
  KO
K14010  translocating chain-associated membrane protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    23471 (TRAM1)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Other DBs
NCBI-GeneID: 23471
NCBI-ProteinID: NP_055109
OMIM: 605190
HGNC: 20568
Ensembl: ENSG00000067167
Vega: OTTHUMG00000164428
Pharos: Q15629(Tbio)
UniProt: Q15629 Q6FHL3
LinkDB
Position
8:complement(70573218..70608416)
AA seq 374 aa
MAIRKKSTKSPPVLSHEFVLQNHADIVSCVAMVFLLGLMFEITAKASIIFVTLQYNVTLP
ATEEQATESVSLYYYGIKDLATVFFYMLVAIIIHAVIQEYMLDKINRRMHFSKTKHSKFN
ESGQLSAFYLFACVWGTFILISENYISDPTILWRAYPHNLMTFQMKFFYISQLAYWLHAF
PELYFQKTKKEDIPRQLVYIGLYLFHIAGAYLLNLNHLGLVLLVLHYFVEFLFHISRLFY
FSNEKYQKGFSLWAVLFVLGRLLTLILSVLTVGFGLARAENQKLDFSTGNFNVLAVRIAV
LASICVTQAFMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVNGTLTS
NVADSPRNKKEKSS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggcgattcgcaagaaaagcaccaagagccccccagtgctgagccacgaattcgtcctg
cagaatcacgcggacatcgtctcctgtgtggcgatggtcttcctgctggggctcatgttt
gagataacggcaaaagcttctatcatttttgttactcttcagtacaatgtcaccctccca
gcaacagaagaacaagctactgaatcagtgtccctttattactatggcatcaaagatttg
gctactgttttcttctacatgctagtggcgataattattcatgccgtaattcaagagtat
atgttggataaaattaacaggcgaatgcacttctccaaaacaaaacacagcaagtttaat
gaatctggtcagcttagtgcgttctacctttttgcctgtgtttggggcacattcattctc
atctctgaaaactacatctcagacccaactatcttatggagggcttatccccataacctg
atgacatttcaaatgaagtttttctacatatcacagctggcttactggcttcatgctttt
cctgaactctacttccagaaaaccaaaaaagaagatattcctcgtcagcttgtctacatt
ggtctttacctcttccacattgctggagcttaccttttgaacttgaatcatctaggactt
gttcttctggtgctacattattttgttgaatttcttttccacatttcccgcctgttttat
tttagcaatgaaaagtatcagaaaggattttctctgtgggcagttctttttgttttggga
agacttctgactttaattctttcagtactgactgttggttttggccttgcaagagcagaa
aatcagaagctggatttcagtactggaaacttcaatgtgttagctgttagaatcgctgtt
ctggcatccatttgcgttactcaggcatttatgatgtggaagttcattaattttcagctt
cgaaggtggagggaacattctgcttttcaggcaccagctgtgaagaagaaaccaacagta
actaaaggcagatcttctaaaaaaggaacagaaaatggtgtgaatggaacattaacttca
aatgtagcagactctccccggaataaaaaagagaaatcttcataa

DBGET integrated database retrieval system