KEGG   Homo sapiens (human): 135250
Entry
135250            CDS       T01001                                 
Symbol
RAET1E, LETAL, N2DL-4, NKG2DL4, RAET1E2, RL-4, ULBP4, bA350J20.7
Name
(RefSeq) retinoic acid early transcript 1E
  KO
K07987  retinoic acid early transcript 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    135250 (RAET1E)
SSDB
Motif
Pfam: MHC_I MHC_I_2
Other DBs
NCBI-GeneID: 135250
NCBI-ProteinID: NP_631904
OMIM: 609243
HGNC: 16793
Ensembl: ENSG00000164520 ENSG00000285991
Pharos: Q8TD07(Tbio)
UniProt: Q8TD07
LinkDB
Position
6:complement(149864432..149898113)
AA seq 263 aa
MRRISLTSSPVRLLLFLLLLLIALEIMVGGHSLCFNFTIKSLSRPGQPWCEAQVFLNKNL
FLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTL
QVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKY
FRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDRWIILGAFILLVLMG
IVLICVWWQNGEWQAGLWPLRTS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgcgaagaatatccctgacttctagccctgtgcgccttcttttgtttctgctgttgcta
ctaatagccttggagatcatggttggtggtcactctctttgcttcaacttcactataaaa
tcattgtccagacctggacagccctggtgtgaagcgcaggtcttcttgaataaaaatctt
ttccttcagtacaacagtgacaacaacatggtcaaacctctgggcctcctggggaagaag
gtatatgccaccagcacttggggagaattgacccaaacgctgggagaagtggggcgagac
ctcaggatgctcctttgtgacatcaaaccccagataaagaccagtgatccttccactctg
caagtcgagatgttttgtcaacgtgaagcagaacggtgcactggtgcatcctggcagttc
gccaccaatggagagaaatccctcctctttgacgcaatgaacatgacctggacagtaatt
aatcatgaagccagtaagatcaaggagacatggaagaaagacagagggctggaaaagtat
ttcaggaagctctcaaagggagactgcgatcactggctcagggaattcttagggcactgg
gaggcaatgccagaaccgacagtgtcaccagtaaatgcttcagatatccactggtcttct
tctagtctaccagatagatggatcatcctgggggcattcatcctgttagttttaatggga
attgttctcatctgtgtctggtggcaaaatggtgagtggcaggctggtctctggcccttg
aggacgtcttag

KEGG   Homo sapiens (human): 154064
Entry
154064            CDS       T01001                                 
Symbol
RAET1L, RAET1H, ULBP6
Name
(RefSeq) retinoic acid early transcript 1L
  KO
K07987  retinoic acid early transcript 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    154064 (RAET1L)
SSDB
Motif
Pfam: MHC_I MHC_I_2
Other DBs
NCBI-GeneID: 154064
NCBI-ProteinID: NP_570970
OMIM: 611047
HGNC: 16798
Ensembl: ENSG00000155918
Pharos: Q5VY80(Tdark)
UniProt: Q5VY80
Structure
LinkDB
Position
6:complement(150018334..150025532)
AA seq 246 aa
MAAAAIPALLLCLPLLFLLFGWSRARRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKT
FLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLT
LQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAM
SFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPC
FILPGI
NT seq 741 nt   +upstreamnt  +downstreamnt
atggcagcagccgccatcccagctttgcttctgtgcctcccgcttctgttcctgctgttc
ggctggtcccgggctaggcgagacgaccctcactctctttgctatgacatcaccgtcatc
cctaagttcagacctggaccacggtggtgtgcggttcaaggccaggtggatgaaaagact
tttcttcactatgactgtggcaacaagacagtcacacccgtcagtcccctggggaagaaa
ctaaatgtcacaatggcctggaaagcacagaacccagtactgagagaggtggtggacata
cttacagagcaactgcttgacattcagctggagaattacacacccaaggaacccctcacc
ctgcaggcaaggatgtcttgtgagcagaaagctgaaggacacagcagtggatcttggcag
ttcagtatcgatggacagaccttcctactctttgactcagagaagagaatgtggacaacg
gttcatcctggagccagaaagatgaaagaaaagtgggagaatgacaaggatgtggccatg
tccttccattacatctcaatgggagactgcataggatggcttgaggacttcttgatgggc
atggacagcaccctggagccaagtgcaggagcaccactcgccatgtcctcaggcacaacc
caactcagggccacagccaccaccctcatcctttgctgcctcctcatcatcctcccctgc
ttcatcctccctggcatctga

KEGG   Homo sapiens (human): 353091
Entry
353091            CDS       T01001                                 
Symbol
RAET1G, ULBP5
Name
(RefSeq) retinoic acid early transcript 1G
  KO
K07987  retinoic acid early transcript 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    353091 (RAET1G)
SSDB
Motif
Pfam: MHC_I MHC_I_2
Other DBs
NCBI-GeneID: 353091
NCBI-ProteinID: NP_001001788
OMIM: 609244
HGNC: 16795
Ensembl: ENSG00000203722
Pharos: Q6H3X3(Tbio)
UniProt: Q6H3X3
LinkDB
Position
6:complement(149916878..149923121)
AA seq 334 aa
MAAAASPAFLLRLPLLLLLSSWCRTGLADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKT
FLHYDCGSKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLLDIQLENYIPKEPLT
LQARMSCEQKAEGHGSGSWQLSFDGQIFLLFDSENRMWTTVHPGARKMKEKWENDKDMTM
SFHYISMGDCTGWLEDFLMGMDSTLEPSAGAPPTMSSGTAQPRATATTLILCCLLIMCLL
ICSRHSLTQSHGHHPQSLQPPPHPPLLHPTWLLRRVLWSDSYQIAKRPLSGGHVTRVTLP
IIGDDSHSLPCPLALYTINNGAARYSEPLQVSIS
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggcagcggccgccagccccgcgttccttctacgcctcccgcttctgctcctgctgtcc
agctggtgcaggaccgggctggccgaccctcactctctttgctatgacatcaccgtcatc
cctaagttcagacctggaccacggtggtgtgcggttcaaggccaggtggatgaaaagact
tttcttcactatgactgtggcagcaagacagtcacacccgtcagtcccctggggaagaaa
ctaaatgtcacaacggcctggaaagcacagaacccagtactgagagaggtggtggacata
cttacagagcaactgcttgacattcagctggagaattacatacccaaggaacccctcacc
ctgcaggccaggatgtcttgtgagcagaaagccgaaggacacggcagtggatcttggcag
ctcagtttcgatggacagatcttcctcctctttgactcagaaaacagaatgtggacaacg
gttcatcctggagccagaaagatgaaagaaaagtgggagaatgacaaggatatgaccatg
tccttccattacatctcaatgggagactgcacaggatggcttgaggacttcttgatgggc
atggacagcaccctggagccaagtgcaggagcaccacccaccatgtcctcaggcacagcc
caacccagggccacggccaccaccctcatcctttgctgcctcctcatcatgtgtctcctc
atatgctccaggcacagtctgacccaaagccatggccaccaccctcagtccctgcagcct
cctcctcatcctcccctgcttcatcctacctggctgctgaggagagtcctttggagtgac
agctaccaaatagcgaagcgccccttgtctggtggacacgtgactcgcgtgactttacct
atcattggagacgactcacactccttaccctgccctcttgccttgtatacaataaataac
ggcgcagccaggtattcggagccactacaggtctccatatcttga

DBGET integrated database retrieval system