KEGG   Homo sapiens (human): 136371
Entry
136371            CDS       T01001                                 
Symbol
ASB10, GLC1F
Name
(RefSeq) ankyrin repeat and SOCS box containing 10
  KO
K10332  ankyrin repeat and SOCS box protein 10
Organism
hsa  Homo sapiens (human)
Disease
H00612  Primary open angle glaucoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    136371 (ASB10)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     136371 (ASB10)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3 SOCS_box Acetyltransf_6
Other DBs
NCBI-GeneID: 136371
NCBI-ProteinID: NP_001135931
OMIM: 615054
HGNC: 17185
Ensembl: ENSG00000146926
Vega: OTTHUMG00000157013
Pharos: Q8WXI3(Tbio)
UniProt: Q8WXI3
LinkDB
Position
7:complement(151175698..151187792)
AA seq 467 aa
MLMSWSPEECKGQGEPLDDRHPLCARLVEKPSRGSEEHLKSGPGPIVTRTASGPALAFWQ
AVLAGDVGCVSRILADSSTGLAPDSVFDTSDPERWRDFRFNIRALRLWSLTYEEELTTPL
HVAASRGHTEVLRLLLRRRARPDSAPGGRTALHEACAAGHTACVHVLLVAGADPNIADQD
GKRPLHLCRGPGTLECAELLLRFGARVDGRSEEEEETPLHVAARLGHVELADLLLRRGAC
PDARNAEGWTPLLAACDVRCQSITDAEATTARCLQLCSLLLSAGADADAADQDKQRPLHL
ACRRGHAAVVELLLSCGVSANTMDYGGHTPLHCALQGPAAALAQSPEHVVRALLNHGAVR
VWPGALPKVLERWSTCPRTIEVLMNTYSVVQLPEEAVGLVTPETLQKHQRFYSSLFALVR
QPRSLQHLSRCALRSHLEGSLPQALPRLPLPPRLLRYLQLDFEGVLY
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgctcatgagttggtctccagaagagtgcaaggggcagggagagcccctcgatgacaga
caccccctctgtgccaggctggtggagaagcccagcagagggtctgaggagcacctcaag
tctggcccgggacccatcgtcacccgcacagcctcaggacctgcccttgccttctggcag
gcagtgctggctggggacgtgggctgtgtctcccgcatcctcgcggactccagtactggc
ctggctcctgattccgtctttgataccagcgacccagagcgatggagggatttccgcttc
aacatccgtgctctgagactctggtctctgacatacgaagaggagctgaccaccccactg
catgtggcagccagccgtggccacacggaagtcctgcggctgctgctgaggcggcgagca
aggccagacagtgcccctgggggccgcaccgccctgcacgaggcctgtgctgcaggccac
actgcctgtgttcatgtgctgctggtggcaggagccgaccccaacatcgctgaccaggat
gggaaacgccccctgcatctctgccgggggcctggcacccttgagtgtgcggagctgctc
ctcaggtttggagcgagagtggatggtcggtccgaggaagaagaggagacccctttgcat
gtggccgcccggcttggccatgtggagctggcagatctgcttctaagacggggggcatgt
cctgatgcccgcaatgccgaaggctggaccccactgctggctgcctgtgacgtccgctgc
cagtccatcaccgatgccgaggccaccaccgcccgctgcctgcagctgtgcagcttgctg
ctttcagctggagcagacgctgatgctgcggaccaggacaagcagcgacccctgcacctg
gcctgccgccgtggccatgcagctgtcgtggagctgctcctgtcctgtggtgtcagcgcc
aacaccatggactatgggggacacacgcccctgcactgtgctctgcagggcccagctgca
gccctggcccagagccccgagcacgtggttcgggctctgctcaaccatggcgccgtccgt
gtctggccaggggccctccccaaggtgctggagcgctggagcacgtgccctcggaccatc
gaggtcctgatgaacacctacagtgttgtgcagcttcccgaggaggccgtcggcctggtg
actcctgaaactctgcagaaacatcagcgtttctactcctccctcttcgccttggtgagg
cagcccaggtcgctgcagcatttgagccgctgtgcgctccgctcccacctggagggcagc
ctgccccaagcgctgccccgcctccccctgccaccgcgcctgctccgctacctgcagctg
gattttgagggcgtgctctactag

DBGET integrated database retrieval system