KEGG   Homo sapiens (human): 137868
Entry
137868            CDS       T01001                                 
Symbol
SGCZ, ZSG1
Name
(RefSeq) sarcoglycan zeta
  KO
K27062  zeta-sarcoglycan
Organism
hsa  Homo sapiens (human)
Pathway
hsa04820  Cytoskeleton in muscle cells
hsa05410  Hypertrophic cardiomyopathy
hsa05412  Arrhythmogenic right ventricular cardiomyopathy
hsa05414  Dilated cardiomyopathy
hsa05416  Viral myocarditis
Network
nt06539  Cytoskeleton in muscle cells
  Element
N01816  Costamere
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    137868 (SGCZ)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    137868 (SGCZ)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    137868 (SGCZ)
   05414 Dilated cardiomyopathy
    137868 (SGCZ)
   05416 Viral myocarditis
    137868 (SGCZ)
SSDB
Motif
Pfam: Sarcoglycan_1 DUF2345
Other DBs
NCBI-GeneID: 137868
NCBI-ProteinID: NP_631906
OMIM: 608113
HGNC: 14075
Ensembl: ENSG00000185053
UniProt: Q96LD1
LinkDB
Position
8:complement(14084845..15238431)
AA seq 312 aa
MDRSTNLDIEELKMTREQYILATQQNNLPRTENAQLYPVGIYGWRKRCLYFFVLLLLVTM
IVNLAMTIWILKVMNFTVDGMGNLRVTKKGIRLEGISEFLLPLYVKEIHSRKDSPLVLQS
DRNVTVNARNHMGQLTGQLTIGADAVEAQCKRFEVRASEDGRVLFSADEDEITIGAEKLK
VTGTEGAVFGHSVETPHIRAEPSQDLRLESPTRSLIMEAPRGVQVSAAAGDFKATCRKEL
HLQSTEGEIFLNAETIKLGNLPTGSFSSSSPSSSSSRQTVYELCVCPNGKLYLSPAGVGS
TCQSSSNICLWS
NT seq 939 nt   +upstreamnt  +downstreamnt
atggacagatcaacgaacctggacattgaggagctcaagatgacacgagaacaatacata
ctagcaacccaacagaataacctgccaaggactgagaatgcacaactttacccagtggga
atttatggatggcgaaagaggtgcttatacttctttgtccttctgctgttggttaccatg
atagttaacttagccatgacaatatggatattgaaagttatgaatttcactgtggatggt
atgggaaatctgagagtcaccaagaagggaatccgacttgaaggtatatctgagtttcta
cttccattgtatgtgaaagaaattcattctcgaaaggatagtccgctggtcttacagtct
gacaggaatgtcacagtgaatgcaagaaatcacatggggcagttaaccggacagctgacc
ataggagctgatgctgtggaagctcagtgtaaaagatttgaagtgagagccagtgaagat
ggcagggtgctgttttctgcagatgaagatgagattaccattggggctgaaaagctgaaa
gttacaggcactgaaggagccgtatttgggcactctgtggagacgccgcacatcagagca
gagccatcccaagatctcaggcttgaatcacccaccagatccttgatcatggaagctccc
cgtggggtccaggtgagtgctgctgcaggagacttcaaggccacctgcaggaaggagctc
catctgcaatctacagaaggggagatatttttaaatgcagagacaatcaagctgggaaat
ctaccaactggctccttctcatcttcttcacccagctcctcaagttctcgacagacagtg
tatgaactctgcgtctgccccaatggcaaactttacctttctccagcaggagtaggttcc
acttgtcagtccagtagcaacatctgcctgtggagctga

KEGG   Homo sapiens (human): 6445
Entry
6445              CDS       T01001                                 
Symbol
SGCG, 35DAG, A4, DAGA4, DMDA, DMDA1, LGMD2C, LGMDR5, MAM, SCARMD2, SCG3, gamma-SG
Name
(RefSeq) sarcoglycan gamma
  KO
K12564  gamma-sarcoglycan
Organism
hsa  Homo sapiens (human)
Pathway
hsa04820  Cytoskeleton in muscle cells
hsa05410  Hypertrophic cardiomyopathy
hsa05412  Arrhythmogenic right ventricular cardiomyopathy
hsa05414  Dilated cardiomyopathy
hsa05416  Viral myocarditis
Network
nt06539  Cytoskeleton in muscle cells
  Element
N01816  Costamere
Disease
H00565  Sarcoglycanopathies
H00593  Limb-girdle muscular dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    6445 (SGCG)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    6445 (SGCG)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    6445 (SGCG)
   05414 Dilated cardiomyopathy
    6445 (SGCG)
   05416 Viral myocarditis
    6445 (SGCG)
SSDB
Motif
Pfam: Sarcoglycan_1 DUF2345 TRAM
Other DBs
NCBI-GeneID: 6445
NCBI-ProteinID: NP_000222
OMIM: 608896
HGNC: 10809
Ensembl: ENSG00000102683
UniProt: Q13326
LinkDB
Position
13:23160508..23325162
AA seq 291 aa
MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKV
MWFSPAGMGHLCVTKDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEG
EVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVE
TPLVRADPFQDLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAE
TVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHNHICL
NT seq 876 nt   +upstreamnt  +downstreamnt
atggtgcgtgagcagtacactacagccacagaaggcatctgcatagagaggccagagaat
cagtatgtctacaaaattggcatttatggctggagaaagcgctgtctctacttgtttgtt
cttcttttactcatcatcctcgttgtgaatttagctcttacaatttggattcttaaagtg
atgtggttttctccagcaggaatgggccacttgtgtgtaacaaaagatggactgcgcttg
gaaggggaatcagaatttttattcccattgtatgccaaagaaatacactccagagtggac
tcatctctgcttctacaatcaacccagaatgtgactgtaaatgcgcgcaactcagaaggg
gaggtcacaggcaggttaaaagtcggtcccaaaatggtagaagtccagaatcaacagttt
cagatcaactccaacgacggcaagccactatttactgtagatgagaaggaagttgtggtt
ggtacagataaacttcgagtaactgggcctgaaggggctctttttgaacattcagtggag
acaccccttgtcagagccgacccgtttcaagaccttagattagaatcccccactcggagt
ctaagcatggatgccccaaggggtgtgcatattcaagctcacgctgggaaaattgaggcg
ctttctcaaatggatattctttttcatagtagtgatggaatgcttgtgcttgatgctgaa
actgtgtgcttacccaagctggtgcaggggacgtggggtccctctggcagctcacagagc
ctctacgaaatctgtgtgtgtccagatgggaagctgtacctgtctgtggccggtgtgagc
accacgtgccaggagcacaaccacatctgcctctga

DBGET integrated database retrieval system