KEGG   Homo sapiens (human): 1462
Entry
1462              CDS       T01001                                 
Symbol
VCAN, CSPG2, ERVR, GHAP, PG-M, WGN, WGN1
Name
(RefSeq) versican
  KO
K06793  versican core protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Disease
H00805  Vitreoretinal degeneration
H02073  Wagner syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    1462 (VCAN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    1462 (VCAN)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1462 (VCAN)
   04091 Lectins [BR:hsa04091]
    1462 (VCAN)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Aggrecan / versican family
   1462 (VCAN)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   1462 (VCAN)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 1: Proteoglycan core proteins
   1462 (VCAN)
SSDB
Motif
Pfam: Xlink Lectin_C V-set EGF hEGF Sushi EGF_3 EGF_2 EGF_CA
Other DBs
NCBI-GeneID: 1462
NCBI-ProteinID: NP_004376
OMIM: 118661
HGNC: 2464
Ensembl: ENSG00000038427
Pharos: P13611(Tbio)
UniProt: P13611 A0A024RAQ9 Q59FG9
LinkDB
Position
5:83471744..83582302
AA seq 3396 aa
MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSE
FLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKL
LASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAAQKACLDVGAVIA
TPEQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCYGDKMGKAGVRTYGFRSPQETYD
VYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLS
DASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPKEATTIDLSILA
ETASPSLSKEPQMVSDRTTPIIPLVDELPVIPTEFPPVGNIVSFEQKATVQPQAITDSLA
TKLPTPTGSTKKPWDMDDYSPSASGPLGKLDISEIKEEVLQSTTGVSHYATDSWDGVVED
KQTQESVTQIEQIEVGPLVTSMEILKHIPSKEFPVTETPLVTARMILESKTEKKMVSTVS
ELVTTGHYGFTLGEEDDEDRTLTVGSDESTLIFDQIPEVITVSKTSEDTIHTHLEDLESV
SASTTVSPLIMPDNNGSSMDDWEERQTSGRITEEFLGKYLSTTPFPSQHRTEIELFPYSG
DKILVEGISTVIYPSLQTEMTHRRERTETLIPEMRTDTYTDEIQEEITKSPFMGKTEEEV
FSGMKLSTSLSEPIHVTESSVEMTKSFDFPTLITKLSAEPTEVRDMEEDFTATPGTTKYD
ENITTVLLAHGTLSVEAATVSKWSWDEDNTTSKPLESTEPSASSKLPPALLTTVGMNGKD
KDIPSFTEDGADEFTLIPDSTQKQLEEVTDEDIAAHGKFTIRFQPTTSTGIAEKSTLRDS
TTEEKVPPITSTEGQVYATMEGSALGEVEDVDLSKPVSTVPQFAHTSEVEGLAFVSYSST
QEPTTYVDSSHTIPLSVIPKTDWGVLVPSVPSEDEVLGEPSQDILVIDQTRLEATISPET
MRTTKITEGTTQEEFPWKEQTAEKPVPALSSTAWTPKEAVTPLDEQEGDGSAYTVSEDEL
LTGSERVPVLETTPVGKIDHSVSYPPGAVTEHKVKTDEVVTLTPRIGPKVSLSPGPEQKY
ETEGSSTTGFTSSLSPFSTHITQLMEETTTEKTSLEDIDLGSGLFEKPKATELIEFSTIK
VTVPSDITTAFSSVDRLHTTSAFKPSSAITKKPPLIDREPGEETTSDMVIIGESTSHVPP
TTLEDIVAKETETDIDREYFTTSSPPATQPTRPPTVEDKEAFGPQALSTPQPPASTKFHP
DINVYIIEVRENKTGRMSDLSVIGHPIDSESKEDEPCSEETDPVHDLMAEILPEFPDIIE
IDLYHSEENEEEEEECANATDVTTTPSVQYINGKHLVTTVPKDPEAAEARRGQFESVAPS
QNFSDSSESDTHPFVIAKTELSTAVQPNESTETTESLEVTWKPETYPETSEHFSGGEPDV
FPTVPFHEEFESGTAKKGAESVTERDTEVGHQAHEHTEPVSLFPEESSGEIAIDQESQKI
AFARATEVTFGEEVEKSTSVTYTPTIVPSSASAYVSEEEAVTLIGNPWPDDLLSTKESWV
EATPRQVVELSGSSSIPITEGSGEAEEDEDTMFTMVTDLSQRNTTDTLITLDTSRIITES
FFEVPATTIYPVSEQPSAKVVPTKFVSETDTSEWISSTTVEEKKRKEEEGTTGTASTFEV
YSSTQRSDQLILPFELESPNVATSSDSGTRKSFMSLTTPTQSEREMTDSTPVFTETNTLE
NLGAQTTEHSSIHQPGVQEGLTTLPRSPASVFMEQGSGEAAADPETTTVSSFSLNVEYAI
QAEKEVAGTLSPHVETTFSTEPTGLVLSTVMDRVVAENITQTSREIVISERLGEPNYGAE
IRGFSTGFPLEEDFSGDFREYSTVSHPIAKEETVMMEGSGDAAFRDTQTSPSTVPTSVHI
SHISDSEGPSSTMVSTSAFPWEEFTSSAEGSGEQLVTVSSSVVPVLPSAVQKFSGTASSI
IDEGLGEVGTVNEIDRRSTILPTAEVEGTKAPVEKEEVKVSGTVSTNFPQTIEPAKLWSR
QEVNPVRQEIESETTSEEQIQEEKSFESPQNSPATEQTIFDSQTFTETELKTTDYSVLTT
KKTYSDDKEMKEEDTSLVNMSTPDPDANGLESYTTLPEATEKSHFFLATALVTESIPAEH
VVTDSPIKKEESTKHFPKGMRPTIQESDTELLFSGLGSGEEVLPTLPTESVNFTEVEQIN
NTLYPHTSQVESTSSDKIEDFNRMENVAKEVGPLVSQTDIFEGSGSVTSTTLIEILSDTG
AEGPTVAPLPFSTDIGHPQNQTVRWAEEIQTSRPQTITEQDSNKNSSTAEINETTTSSTD
FLARAYGFEMAKEFVTSAPKPSDLYYEPSGEGSGEVDIVDSFHTSATTQATRQESSTTFV
SDGSLEKHPEVPSAKAVTADGFPTVSVMLPLHSEQNKSSPDPTSTLSNTVSYERSTDGSF
QDRFREFEDSTLKPNRKKPTENIIIDLDKEDKDLILTITESTILEILPELTSDKNTIIDI
DHTKPVYEDILGMQTDIDTEVPSEPHDSNDESNDDSTQVQEIYEAAVNLSLTEETFEGSA
DVLASYTQATHDESMTYEDRSQLDHMGFHFTTGIPAPSTETELDVLLPTATSLPIPRKSA
TVIPEIEGIKAEAKALDDMFESSTLSDGQAIADQSEIIPTLGQFERTQEEYEDKKHAGPS
FQPEFSSGAEEALVDHTPYLSIATTHLMDQSVTEVPDVMEGSNPPYYTDTTLAVSTFAKL
SSQTPSSPLTIYSGSEASGHTEIPQPSALPGIDVGSSVMSPQDSFKEIHVNIEATFKPSS
EEYLHITEPPSLSPDTKLEPSEDDGKPELLEEMEASPTELIAVEGTEILQDFQNKTDGQV
SGEAIKMFPTIKTPEAGTVITTADEIELEGATQWPHSTSASATYGVEAGVVPWLSPQTSE
RPTLSSSPEINPETQAALIRGQDSTIAASEQQVAARILDSNDQATVNPVEFNTEVATPPF
SLLETSNETDFLIGINEESVEGTAIYLPGPDRCKMNPCLNGGTCYPTETSYVCTCVPGYS
GDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQC
YKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWT
DGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPP
VVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQR
TYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR
NT seq 10191 nt   +upstreamnt  +downstreamnt
atgttcataaatataaagagcatcttatggatgtgttcaaccttaatagtaacccatgcg
ctacataaagtcaaagtgggaaaaagcccaccggtgaggggctccctctctggaaaagtc
agcctaccttgtcatttttcaacgatgcctactttgccacccagttacaacaccagtgaa
tttctccgcatcaaatggtctaagattgaagtggacaaaaatggaaaagatttgaaagag
actactgtccttgtggcccaaaatggaaatatcaagattggtcaggactacaaagggaga
gtgtctgtgcccacacatcccgaggctgtgggcgatgcctccctcactgtggtcaagctg
ctggcaagtgatgcgggtctttaccgctgtgacgtcatgtacgggattgaagacacacaa
gacacggtgtcactgactgtggatggggttgtgtttcactacagggcggcaaccagcagg
tacacactgaattttgaggctgctcagaaggcttgtttggacgttggggcagtcatagca
actccagagcagctctttgctgcctatgaagatggatttgagcagtgtgacgcaggctgg
ctggctgatcagactgtcagatatcccatccgggctcccagagtaggctgttatggagat
aagatgggaaaggcaggagtcaggacttatggattccgttctccccaggaaacttacgat
gtgtattgttatgtggatcatctggatggtgatgtgttccacctcactgtccccagtaaa
ttcaccttcgaggaggctgcaaaagagtgtgaaaaccaggatgccaggctggcaacagtg
ggggaactccaggcggcatggaggaacggctttgaccagtgcgattacgggtggctgtcg
gatgccagcgtgcgccaccctgtgactgtggccagggcccagtgtggaggtggtctactt
ggggtgagaaccctgtatcgttttgagaaccagacaggcttccctccccctgatagcaga
tttgatgcctactgctttaaacctaaagaggctacaaccatcgatttgagtatcctcgca
gaaactgcatcacccagtttatccaaagaaccacaaatggtttctgatagaactacacca
atcatccctttagttgatgaattacctgtcattccaacagagttccctcccgtgggaaat
attgtcagttttgaacagaaagccacagtccaacctcaggctatcacagatagtttagcc
accaaattacccacacctactggcagtaccaagaagccctgggatatggatgactactca
ccttctgcttcaggacctcttggaaagctagacatatcagaaattaaggaagaagtgctc
cagagtacaactggcgtctctcattatgctacggattcatgggatggtgtcgtggaagat
aaacaaacacaagaatcggttacacagattgaacaaatagaagtgggtcctttggtaaca
tctatggaaatcttaaagcacattccttccaaggaattccctgtaactgaaacaccattg
gtaactgcaagaatgatcctggaatccaaaactgaaaagaaaatggtaagcactgtttct
gaattggtaaccacaggtcactatggattcaccttgggagaagaggatgatgaagacaga
acacttacagttggatctgatgagagcaccttgatctttgaccaaattcctgaagtcatt
acggtgtcaaagacttcagaagacaccatccacactcatttagaagacttggagtcagtc
tcagcatccacaactgtttcccctttaattatgcctgataataatggatcatccatggat
gactgggaagagagacaaactagtggtaggataacggaagagtttcttggcaaatatctg
tctactacaccttttccatcacagcatcgtacagaaatagaattgtttccttattctggt
gataaaatattagtagagggaatttccacagttatttatccttctctacaaacagaaatg
acacatagaagagaaagaacagaaacactaataccagagatgagaacagatacttataca
gatgaaatacaagaagagatcactaaaagtccatttatgggaaaaacagaagaagaagtc
ttctctgggatgaaactctctacatctctctcagagccaattcatgttacagagtcttct
gtggaaatgaccaagtcttttgatttcccaacattgataacaaagttaagtgcagagcca
acagaagtaagagatatggaggaagactttacagcaactccaggtactacaaaatatgat
gaaaatattacaacagtgcttttggcccatggtactttaagtgttgaagcagccactgta
tcaaaatggtcatgggatgaagataatacaacatccaagcctttagagtctacagaacct
tcagcctcttcaaaattgccccctgccttactcacaactgtggggatgaatggaaaggat
aaagacatcccaagtttcactgaagatggagcagatgaatttactcttattccagatagt
actcaaaagcagttagaggaggttactgatgaagacatagcagcccatggaaaattcaca
attagatttcagccaactacatcaactggtattgcagaaaagtcaactttgagagattct
acaactgaagaaaaagttccacctatcacaagcactgaaggccaagtttatgcaaccatg
gaaggaagtgctttgggtgaagtagaagatgtggacctctctaagccagtatctactgtt
ccccaatttgcacacacttcagaggtggaaggattagcatttgttagttatagtagcacc
caagagcctactacttatgtagactcttcccataccattcctctttctgtaattcccaag
acagactggggagtgttagtaccttctgttccatcagaagatgaagttctaggtgaaccc
tctcaagacatacttgtcattgatcagactcgccttgaagcgactatttctccagaaact
atgagaacaacaaaaatcacagagggaacaactcaggaagaattcccttggaaagaacag
actgcagagaaaccagttcctgctctcagttctacagcttggactcccaaggaggcagta
acaccactggatgaacaagagggcgatggatcagcatatacagtctctgaagatgaattg
ttgacaggttctgagagggtcccagttttagaaacaactccagttggaaaaattgatcac
agtgtgtcttatccaccaggtgctgtaactgagcacaaagtgaaaacagatgaagtggta
acactaacaccacgcattgggccaaaagtatctttaagtccagggcctgaacaaaaatat
gaaacagaaggtagtagtacaacaggatttacatcatctttgagtccttttagtacccac
attacccagcttatggaagaaaccactactgagaaaacatccctagaggatattgattta
ggctcaggattatttgaaaagcccaaagccacagaactcatagaattttcaacaatcaaa
gtcacagttccaagtgatattaccactgccttcagttcagtagacagacttcacacaact
tcagcattcaagccatcttccgcgatcactaagaaaccacctctcatcgacagggaacct
ggtgaagaaacaaccagtgacatggtaatcattggagaatcaacatctcatgttcctccc
actacccttgaagatattgtagccaaggaaacagaaaccgatattgatagagagtatttc
acgacttcaagtcctcctgctacacagccaacaagaccacccactgtggaagacaaagag
gcctttggacctcaggcgctttctacgccacagcccccagcaagcacaaaatttcaccct
gacattaatgtttatattattgaggtcagagaaaataagacaggtcgaatgagtgatttg
agtgtaattggtcatccaatagattcagaatctaaagaagatgaaccttgtagtgaagaa
acagatccagtgcatgatctaatggctgaaattttacctgaattccctgacataattgaa
atagacctataccacagtgaagaaaatgaagaagaagaagaagagtgtgcaaatgctact
gatgtgacaaccaccccatctgtgcagtacataaatgggaagcatctcgttaccactgtg
cccaaggacccagaagctgcagaagctaggcgtggccagtttgaaagtgttgcaccttct
cagaatttctcggacagctctgaaagtgatactcatccatttgtaatagccaaaacggaa
ttgtctactgctgtgcaacctaatgaatctacagaaacaactgagtctcttgaagttaca
tggaagcctgagacttaccctgaaacatcagaacatttttcaggtggtgagcctgatgtt
ttccccacagtcccattccatgaggaatttgaaagtggaacagccaaaaaaggggcagaa
tcagtcacagagagagatactgaagttggtcatcaggcacatgaacatactgaacctgta
tctctgtttcctgaagagtcttcaggagagattgccattgaccaagaatctcagaaaata
gcctttgcaagggctacagaagtaacatttggtgaagaggtagaaaaaagtacttctgtc
acatacactcccactatagttccaagttctgcatcagcatatgtttcagaggaagaagca
gttaccctaataggaaatccttggccagatgacctgttgtctaccaaagaaagctgggta
gaagcaactcctagacaagttgtagagctctcagggagttcttcgattccaattacagaa
ggctctggagaagcagaagaagatgaagatacaatgttcaccatggtaactgatttatca
cagagaaatactactgatacactcattactttagacactagcaggataatcacagaaagc
ttttttgaggttcctgcaaccaccatttatccagtttctgaacaaccttctgcaaaagtg
gtgcctaccaagtttgtaagtgaaacagacacttctgagtggatttccagtaccactgtt
gaggaaaagaaaaggaaggaggaggagggaactacaggtacggcttctacatttgaggta
tattcatctacacagagatcggatcaattaattttaccctttgaattagaaagtccaaat
gtagctacatctagtgattcaggtaccaggaaaagttttatgtccttgacaacaccaaca
cagtctgaaagggaaatgacagattctactcctgtctttacagaaacaaatacattagaa
aatttgggggcacagaccactgagcacagcagtatccatcaacctggggttcaggaaggg
ctgaccactctcccacgtagtcctgcctctgtctttatggagcagggctctggagaagct
gctgccgacccagaaaccaccactgtttcttcattttcattaaacgtagagtatgcaatt
caagccgaaaaggaagtagctggcactttgtctccgcatgtggaaactacattctccact
gagccaacaggactggttttgagtacagtaatggacagagtagttgctgaaaatataacc
caaacatccagggaaatagtgatttcagagcgattaggagaaccaaattatggggcagaa
ataaggggcttttccacaggttttcctttggaggaagatttcagtggtgactttagagaa
tactcaacagtgtctcatcccatagcaaaagaagaaacggtaatgatggaaggctctgga
gatgcagcatttagggacacccagacttcaccatctacagtacctacttcagttcacatc
agtcacatatctgactcagaaggacccagtagcaccatggtcagcacttcagccttcccc
tgggaagagtttacatcctcagctgagggctcaggtgagcaactggtcacagtcagcagc
tctgttgttccagtgcttcccagtgctgtgcaaaagttttctggtacagcttcctccatt
atcgacgaaggattgggagaagtgggtactgtcaatgaaattgatagaagatccaccatt
ttaccaacagcagaagtggaaggtacgaaagctccagtagagaaggaggaagtaaaggtc
agtggcacagtttcaacaaactttccccaaactatagagccagccaaattatggtctagg
caagaagtcaaccctgtaagacaagaaattgaaagtgaaacaacatcagaggaacaaatt
caagaagaaaagtcatttgaatcccctcaaaactctcctgcaacagaacaaacaatcttt
gattcacagacatttactgaaactgaactcaaaaccacagattattctgtactaacaaca
aagaaaacttacagtgatgataaagaaatgaaggaggaagacacttctttagttaacatg
tctactccagatccagatgcaaatggcttggaatcttacacaactctccctgaagctact
gaaaagtcacattttttcttagctactgcattagtaactgaatctataccagctgaacat
gtagtcacagattcaccaatcaaaaaggaagaaagtacaaaacattttccgaaaggcatg
agaccaacaattcaagagtcagatactgagctcttattctctggactgggatcaggagaa
gaagttttacctactctaccaacagagtcagtgaattttactgaagtggaacaaatcaat
aacacattatatccccacacttctcaagtggaaagtacctcaagtgacaaaattgaagac
tttaacagaatggaaaatgtggcaaaagaagttggaccactcgtatctcaaacagacatc
tttgaaggtagtgggtcagtaaccagcacaacattaatagaaattttaagtgacactgga
gcagaaggacccacggtggcacctctccctttctccacggacatcggacatcctcaaaat
cagactgtcaggtgggcagaagaaatccagactagtagaccacaaaccataactgaacaa
gactctaacaagaattcttcaacagcagaaattaacgaaacaacaacctcatctactgat
tttctggctagagcttatggttttgaaatggccaaagaatttgttacatcagcaccaaaa
ccatctgacttgtattatgaaccttctggagaaggatctggagaagtggatattgttgat
tcatttcacacttctgcaactactcaggcaaccagacaagaaagcagcaccacatttgtt
tctgatgggtccctggaaaaacatcctgaggtgccaagcgctaaagctgttactgctgat
ggattcccaacagtttcagtgatgctgcctcttcattcagagcagaacaaaagctcccct
gatccaactagcacactgtcaaatacagtgtcatatgagaggtccacagacggtagtttc
caagaccgtttcagggaattcgaggattccaccttaaaacctaacagaaaaaaacccact
gaaaatattatcatagacctggacaaagaggacaaggatttaatattgacaattacagag
agtaccatccttgaaattctacctgagctgacatcggataaaaatactatcatagatatt
gatcatactaaacctgtgtatgaagacattcttggaatgcaaacagatatagatacagag
gtaccatcagaaccacatgacagtaatgatgaaagtaatgatgacagcactcaagttcaa
gagatctatgaggcagctgtcaacctttctttaactgaggaaacatttgagggctctgct
gatgttctggctagctacactcaggcaacacatgatgaatcaatgacttatgaagataga
agccaactagatcacatgggctttcacttcacaactgggatccctgctcctagcacagaa
acagaattagacgttttacttcccacggcaacatccctgccaattcctcgtaagtctgcc
acagttattccagagattgaaggaataaaagctgaagcaaaagccctggatgacatgttt
gaatcaagcactttgtctgatggtcaagctattgcagaccaaagtgaaataataccaaca
ttgggccaatttgaaaggactcaggaggagtatgaagacaaaaaacatgctggtccttct
tttcagccagaattctcttcaggagctgaggaggcattagtagaccatactccctatcta
agtattgctactacccaccttatggatcagagtgtaacagaggtgcctgatgtgatggaa
ggatccaatcccccatattacactgatacaacattagcagtttcaacatttgcgaagttg
tcttctcagacaccatcatctcccctcactatctactcaggcagtgaagcctctggacac
acagagatcccccagcccagtgctctgccaggaatagacgtcggctcatctgtaatgtcc
ccacaggattcttttaaggaaattcatgtaaatattgaagcgactttcaaaccatcaagt
gaggaataccttcacataactgagcctccctctttatctcctgacacaaaattagaacct
tcagaagatgatggtaaacctgagttattagaagaaatggaagcttctcccacagaactt
attgctgtggaaggaactgagattctccaagatttccaaaacaaaaccgatggtcaagtt
tctggagaagcaatcaagatgtttcccaccattaaaacacctgaggctggaactgttatt
acaactgccgatgaaattgaattagaaggtgctacacagtggccacactctacttctgct
tctgccacctatggggtcgaggcaggtgtggtgccttggctaagtccacagacttctgag
aggcccacgctttcttcttctccagaaataaaccctgaaactcaagcagctttaatcaga
gggcaggattccacgatagcagcatcagaacagcaagtggcagcgagaattcttgattcc
aatgatcaggcaacagtaaaccctgtggaatttaatactgaggttgcaacaccaccattt
tcccttctggagacttctaatgaaacagatttcctgattggcattaatgaagagtcagtg
gaaggcacggcaatctatttaccaggacctgatcgctgcaaaatgaacccgtgccttaac
ggaggcacctgttatcctactgaaacttcctacgtatgcacctgtgtgccaggatacagc
ggagaccagtgtgaacttgattttgatgaatgtcactctaatccctgtcgtaatggagcc
acttgtgttgatggttttaacacattcaggtgcctctgccttccaagttatgttggtgca
ctttgtgagcaagataccgagacatgtgactatggctggcacaaattccaagggcagtgc
tacaaatactttgcccatcgacgcacatgggatgcagctgaacgggaatgccgtctgcag
ggtgcccatctcacaagcatcctgtctcacgaagaacaaatgtttgttaatcgtgtgggc
catgattatcagtggataggcctcaatgacaagatgtttgagcatgacttccgttggact
gatggcagcacactgcaatacgagaattggagacccaaccagccagacagcttcttttct
gctggagaagactgtgttgtaatcatttggcatgagaatggccagtggaatgatgttccc
tgcaattaccatctcacctatacgtgcaagaaaggaacagtcgcttgcggccagccccct
gttgtagaaaatgccaagacctttggaaagatgaaacctcgttatgaaatcaactccctg
attagataccactgcaaagatggtttcattcaacgtcaccttccaactatccggtgctta
ggaaatggaagatgggctatacctaaaattacctgcatgaacccatctgcataccaaagg
acttattctatgaaatactttaaaaattcctcatcagcaaaggacaattcaataaataca
tccaaacatgatcatcgttggagccggaggtggcaggagtcgaggcgctga

DBGET integrated database retrieval system