KEGG   Homo sapiens (human): 146433
Entry
146433            CDS       T01001                                 
Symbol
IL34, C16orf77, IL-34
Name
(RefSeq) interleukin 34
  KO
K22633  interleukin 34
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01280  IL34/CSF1 to CSF1R signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    146433 (IL34)
   04061 Viral protein interaction with cytokine and cytokine receptor
    146433 (IL34)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    146433 (IL34)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   146433 (IL34)
SSDB
Motif
Pfam: IL34
Other DBs
NCBI-GeneID: 146433
NCBI-ProteinID: NP_001166243
OMIM: 612081
HGNC: 28529
Ensembl: ENSG00000157368
Pharos: Q6ZMJ4(Tbio)
UniProt: Q6ZMJ4 A0A024QZ87
Structure
LinkDB
Position
16:70579899..70660682
AA seq 242 aa
MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPI
NYKISVPYEGVFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQ
EVETLLLNVQQGLTDVEVSPKVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCC
KQSSVLNWQDCEVPSPQSCSPEPSLQYAATQLYPPPPWSPSSPPHSTGSVRPVRAQGEGL
LP
NT seq 729 nt   +upstreamnt  +downstreamnt
atgccccggggcttcacctggctgcgctatcttgggatcttccttggcgtggccttgggg
aatgagcctttggagatgtggcccttgacgcagaatgaggagtgcactgtcacgggtttt
ctgcgggacaagctgcagtacaggagccgacttcagtacatgaaacactacttccccatc
aactacaagatcagtgtgccttacgagggggtgttcagaatcgccaacgtcaccaggctg
cagagggcccaggtgagcgagcgggagctgcggtatctgtgggtcttggtgagcctcagt
gccactgagtcggtgcaggacgtgctgctcgagggccacccatcctggaagtacctgcag
gaggtggagacgctgctgctgaatgtccagcagggcctcacggatgtggaggtcagcccc
aaggtggaatccgtgttgtccctcttgaatgccccagggccaaacctgaagctggtgcgg
cccaaagccctgctggacaactgcttccgggtcatggagctgctgtactgctcctgctgt
aaacaaagctccgtcctaaactggcaggactgtgaggtgccaagtcctcagtcttgcagc
ccagagccctcattgcagtatgcggccacccagctgtaccctccgcccccgtggtccccc
agctccccgcctcactccacgggctcggtgaggccggtcagggcacagggcgagggcctc
ttgccctga

DBGET integrated database retrieval system