KEGG   Homo sapiens (human): 146754
Entry
146754            CDS       T01001                                 

Gene name
DNAH2, DNAHC2, DNHD3, SPGF45
Definition
(RefSeq) dynein axonemal heavy chain 2
  KO
K10408  dynein heavy chain, axonemal
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    146754 (DNAH2)
   05016 Huntington disease
    146754 (DNAH2)
   05022 Pathways of neurodegeneration - multiple diseases
    146754 (DNAH2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    146754 (DNAH2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     146754 (DNAH2)
SSDB
Motif
Pfam: AAA_6 DHC_N2 DHC_N1 AAA_8 Dynein_C AAA_9 AAA_7 MT AAA_lid_11 Dynein_heavy AAA_5 Dynein_AAA_lid AAA_lid_1 AAA AAA_22 AAA_16 TsaE Mg_chelatase Sigma54_activat NB-ARC Sigma54_activ_2 DUF3452 DUF815 AAA_2 CbiA cobW Bac_DnaA ATP_bind_1 Guanylate_kin
Other DBs
NCBI-GeneID: 146754
NCBI-ProteinID: NP_065928
OMIM: 603333
HGNC: 2948
Ensembl: ENSG00000183914
Vega: OTTHUMG00000178020
Pharos: Q9P225(Tdark)
UniProt: Q9P225
LinkDB
Position
17p13.1
AA seq 4427 aa
MSSKAEKKQRLSGRGSSQASWSGRATRAAVATQEQGNAPAVSEPELQAELPKEEPEPRLE
GPQAQSEESVEPEADVKPLFLSRAALTGLADAVWTQEHDAILEHFAQDPTESILTIFIDP
CFGLKLELGMPVQTQNQLVYFIRQAPVPITWENFEATVQFGTVRGPYIPALLRLLGGVFA
PQIFANTGWPESIRNHFASHLHKFLACLTDTRYKLEGHTVLYIPAEAMNMKPEMVIKDKE
LVQRLETSMIHWTRQIKEMLSAQETVETGENLGPLEEIEFWRNRCMDLSGISKQLVKKGV
KHVESILHLAKSSYLAPFMKLAQQIQDGSRQAQSNLTFLSILKEPYQELAFMKPKDISSK
LPKLISLIRIIWVNSPHYNTRERLTSLFRKVCDCQYHFARWEDGKQGPLPCFFGAQGPQI
TRNLLEIEDIFHKNLHTLRAVRGGILDVKNTCWHEDYNKFRAGIKDLEVMTQNLITSAFE
LVRDVPHGVLLLDTFHRLASREAIKRTYDKKAVDLYMLFNSELALVNRERNKKWPDLEPY
VAQYSGKARWVHILRRRIDRVMTCLAGAHFLPRIGTGKESVHTYQQMVQAIDELVRKTFQ
EWTSSLDKDCIRRLDTPLLRISQEKAGMLDVNFDKSLLILFAEIDYWERLLFETPHYVVN
VAERAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKERIRLLDKKIHPGLKKLHWALK
GASAFFITECRIHASKVQMIVNEFKASTLTIGWRAQEMSEKLLVRISGKRVYRDLEFEED
QREHRAAVQQKLMNLHQDVVTIMTNSYEVFKNDGPEIQQQWMLYMIRLDRMMEDALRLNV
KWSLLELSKAINGDGKTSPNPLFQVLVILKNDLQGSVAQVEFSPTLQTLAGVVNDIGNHL
FSTISVFCHLPDILTKRKLHREPIQTVVEQDEDIKKIQTQISSGMTNNASLLQNYLKTWD
MYREIWEINKDSFIHRYQRLNPPVSSFVADIARYTEVANNVQKEETVTNIQFVLLDCSHL
KFSLVQHCNEWQNKFATLLREMAAGRLLELHTYLKENAEKISRPPQTLEELGVSLQLVDA
LKHDLANVETQIPPIHEQFAILEKYEVPVEDSVLEMLDSLNGEWVVFQQTLLDSKQMLKK
HKEKFKTGLIHSADDFKKKAHTLLEDFEFKGHFTSNVGYMSALDQITQVRAMLMAMREEE
NSLRANLGIFKIEQPPSKDLQNLEKELDALQQIWEIARDWEENWNEWKTGRFLILQTETM
ETTAHGLFRRLTKLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVR
DEIQREFDQESESFTLEQIVELGMDQHVEKIGEISASATKELAIEVALQNIAKTWDVTQL
DIVPYKDKGHHRLRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVI
EMILTVQRQWMYLENIFLGEDIRKQLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTHHP
GLLDTLIEMNTILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLK
KCFDNIKLLRIQKVGGPSSKWEAVGMFSGDGEYIDFLHSVFLEGPVESWLGDVEQTMRVT
LRDLLRNCHLALRKFLNKRDKWVKEWAGQVVITASQIQWTADVTKCLLTAKERADKKILK
VMKKNQVSILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVNSFDWL
SQLRFYWEKDLDDCVIRQTNTQFQYNYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGS
PKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRI
NIEVLSVVAHQILCILSALAAGLTHFHFDGFEINLVWSCGIFITMNPGYAGRTELPENLK
SMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRAL
TSLLRYAGKKRRLQPDLTDEEVLLLSMRDMNIAKLTSVDAPLFNAIVQDLFPNIELPVID
YGKLRETVEQEIRDMGLQSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQAS
LSSLCRAGDPNFNIVREFPLNPKALSLGELYGEYDLSTNEWTDGILSSVMRTACADEKPD
EKWILFDGPVDTLWIENMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAMASPATVS
RCGMVYTDYADLGWKPYVQSWLEKRPKAEVEPLQRMFEKLINKMLAFKKDNCKELVPLPE
YSGITSLCKLYSALATPENGVNPADGENYVTMVEMTFVFSMIWSVCASVDEEGRKRIDSY
LREIEGSFPNKDTVYEYFVDPKIRSWTSFEDKLPKSWRYPPNAPFYKIMVPTVDTVRYNY
LVSSLVANQNPILLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIES
RVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRTKQTIK
YIREMFLMAAMGPPGGGRTVISPRLRSRFNIINMTFPTKSQIIRIFGTMINQKLQDFEEE
VKPIGNVVTEATLDMYNTVVQRFLPTPTKMHYLFNLRDISKVFQGMLRANKDFHDTKSSI
TRLWIHECFRVFSDRLVDAADTEAFMGIISDKLGSFFDLTFHHLCPSKRPPIFGDFLKEP
KVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLL
VGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFIFV
DTQIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARVEQVPESSDSLFAYLIE
RVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAEKCLIGVDLG
TQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTKYLELLSGYKKLLGEKRQEL
LAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQ
KAVTANSEKIAVEEIKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPP
AQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPD
FQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEK
LREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGL
EEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCN
PTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQ
MSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTN
FRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVIN
IAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINT
DLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRID
YLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREG
QMDNPCSSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWYTNAAPEKAMLPGEWE
NACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFI
LSPGVDPTSALLQLAEHMGMAQRFHALSLGQGQAPIAARLLREGVTQGHWVFLANCHLSL
SWMPNLDKLVEQLQVEDPHPSFRLWLSSIPHPDFPISILQVSIKMTTEPPKGLKANMTRL
YQLMSEPQFSRCSKPAKYKKLLFSLCFFHSVLLERKKFLQLGWNIIYGFNDSDFEVSENL
LSLYLDEYEETPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLSTPFHRLSA
LETYFIPKDGSLASYKEYISLLPGMDPPEAFGQHPNADVASQITEAQTLFDTLLSLQPQI
TPTRAGGQTREEKVLELAADVKQKIPEMIDYEGTQKLLALDPSPLNVVLLQEIQRYNTLM
QTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKAYPSQKPLAAWTRDLAMR
VEQFELWASRARPPVIFWLSGFTFPTGFLTAVLQSSARQNNVSVDSLSWEFIVSTVDDSN
LVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYS
CPCYYYPNRAGSSDRASFVIGIDLRSGAMTPDHWIKRGTALLMSLDS
NT seq 13284 nt   +upstreamnt  +downstreamnt
atgtccagcaaagctgagaagaagcagcgattgagtggccgaggaagctcccaggcaagc
tggtcagggcgggccactcgggctgctgtggccacacaggagcaggggaatgccccggct
gtcagtgagccagagctgcaggctgagctccccaaggaggagcctgagccacggttggag
ggacctcaagcacagagtgaagaatcagtggagcccgaggcagatgtgaagcccctcttc
ctttcccgagctgcgctgacaggactggcggatgcagtgtggacacaggagcatgatgcc
attctggaacactttgcccaggaccctacagaatccatcctcaccatcttcattgaccct
tgttttgggctgaagctagagctgggcatgcctgtacagacccagaaccagcttgtctac
ttcattcgccaagcaccagttcccatcacctgggagaacttcgaggcaactgtgcagttt
gggacggtgcggggcccctatatcccggccctgcttcggctgctcggtggagtctttgcc
cctcagatctttgcaaacacaggctggcctgagagcattagaaatcattttgcttctcat
ctgcacaagttcttggcctgcctgacagacactcggtacaaactggaggggcacacggtc
ctctacatccctgcagaggccatgaacatgaagcctgagatggtgataaaggacaaagag
ctggtgcaacggctagagacctccatgatccactggacccggcagataaaggagatgctc
agtgcccaggagactgtggagacaggagaaaatttaggtcctctggaggagattgagttc
tggcgcaaccgatgcatggacctgtctggcatcagtaagcagctggtgaagaagggagtg
aagcacgttgaatccatcctgcaccttgccaagtcgtcctacttggcgccctttatgaaa
ctggcacagcagatccaggatggctctcgtcaagcacagtcaaacctgacctttttgtca
atcctgaaggaaccttaccaggagttggctttcatgaagcccaaggacatctctagcaag
ctccctaagctgatcagtctcatccgcatcatctgggtcaactctccccactacaacact
cgggagagactgacctcgctcttccgaaaggtatgtgactgtcagtatcacttcgcccgc
tgggaagatggcaagcagggtccccttccttgcttctttggtgcccaggggccacagata
acacggaacttgctggagattgaggacatctttcataaaaatctgcacacgctgcgagcc
gttcgcgggggtatcctggatgtcaagaacacctgttggcatgaagactacaataagttc
cgtgccggaatcaaggacctggaggtgatgacccagaacctgatcacctcagccttcgag
ttggtgcgggacgtgccgcacggcgtgcttctgctggacaccttccacaggcttgcctcc
cgcgaggctatcaagcggacttatgacaagaaggcggtggatctctacatgctgttcaat
agcgagctggccctggtgaaccgtgaacggaacaagaaatggccagacctggagccctac
gtggcccagtattccggaaaggcgcgctgggtgcacatcctccggcgtcgcatcgacaga
gtcatgacctgccttgctggtgctcatttcctgccccgtattgggactggaaaggagagt
gtgcacacctatcagcagatggtccaggccattgatgagctggttcgaaaaaccttccaa
gagtggacatcaagtctggacaaggattgcattcggcggttggataccccattgctgcga
atcagccaggagaaggcgggcatgctggatgtcaactttgacaagtcccttctgattctc
tttgcggaaattgactactgggagcggctgctgtttgagacgccccattacgtggtgaac
gtagctgagcgagccgaggacctgcgcattctgcgtgaaaatctgctactcgttgctaga
gactacaataggattattgccatgctgtccccagatgagcaggccctattcaaagagcgt
attcggctcctggataagaagatccacccgggactcaagaaactgcactgggccttgaag
ggggccagtgccttcttcatcacggagtgccgtatacatgccagcaaggtgcagatgatt
gtgaatgagttcaaggcatccactctgaccattggctggcgagcccaagagatgtcagag
aagctgctggtacgcattagtggcaaacgggtatacagggacctggaatttgaagaggac
caaagagagcatcgggcagctgtacagcagaaattgatgaacctgcaccaggatgtggtg
accatcatgaccaactcctatgaggtcttcaagaatgatggtcctgagattcagcagcag
tggatgctgtacatgattcggctggaccgcatgatggaggatgccctgcgcctgaatgtg
aagtggtcactgctagaactatccaaggctatcaacggggatggaaagaccagcccaaac
ccactcttccaagtccttgtcattttgaagaatgatctgcaaggaagtgtggcacaggtg
gaattctcacccactctgcagactttggcaggtgtggtcaatgacattggcaaccacctc
ttttccaccatctctgtcttctgccacctccctgacattctcaccaagcgcaagttacat
cgtgaacccatccaaacagttgtggagcaagatgaggacatcaagaagatccagacccaa
atcagcagcggcatgactaacaacgcaagcctgctgcagaactacctcaagacctgggac
atgtaccgggagatctgggagatcaacaaggactccttcattcatcgctaccagcgcctc
aaccctcctgtctcttcttttgttgccgacattgcccgctacacggaagttgctaataac
gtgcagaaggaggagacagtcaccaacatccagtttgtgctgctggactgttcgcacctc
aagttctccctggtgcagcactgcaatgaatggcagaacaagttcgcgactctgctcagg
gagatggctgctgggcgcctcctggagctgcacacctacctgaaggagaacgcagagaaa
atcagccgccctccgcagacactggaggaactgggggtcagcttgcagctcgtggatgcc
ctgaagcacgacttggccaacgtggagactcagatccctcccatacacgagcaatttgcc
attcttgaaaagtacgaggtgccagtcgaggacagtgtcctggagatgctggacagtctc
aacggggagtgggttgtcttccaacaaactctgctggacagtaagcaaatgctgaagaaa
cacaaggagaaattcaagacaggcctgatccactcggcagatgacttcaagaagaaagca
catacacttctggaagatttcgaattcaaaggccatttcaccagcaacgtgggatacatg
tctgccttagaccagattacacaagtgcgggccatgctgatggccatgcgggaagaggaa
aatagtctccgagccaacctgggcatcttcaagatcgagcagccaccctccaaggacctt
cagaacctggagaaggagctcgatgccctccagcaaatctgggagatcgcacgagactgg
gaggagaactggaatgagtggaagactggccggttcctgatcctgcagacggaaaccatg
gagaccacggcccacgggctgtttcgtcgcctcacaaaattagccaaagagtataaggac
cgaaactgggaaattattgaaaccactcgctcaaaaatagagcagttcaagaggaccatg
cctctcatctcagacctgcggaaccctgcccttagagagaggcactgggaccaggtccgg
gatgagatccagcgggagtttgatcaggaatctgaaagcttcaccttggagcagattgtg
gagcttgggatggatcagcatgtggagaaaattggggagatctctgcttcagcaactaaa
gagctggctatagaagtggctttacaaaacattgccaagacctgggatgtgactcagctc
gacatagtaccctacaaggataagggccatcatcggctcagaggtacagaagaagtattc
caggcactggaagataaccaggtagctctgtctaccatgaaggcatcacgctttgtcaag
gcctttgagaaggatgtggaccactgggaacgctgcctctccctcattttggaggttatt
gagatgattctcacagtgcagcgtcagtggatgtacttagagaatatcttcctaggagaa
gacatccgcaagcagctgcccaatgaatcgaccttatttgaccaggtcaacagcaactgg
aaagccatcatggacaggatgaacaaggacaacaatgctctccggagcacccatcaccca
ggcctcctggacacattgatagaaatgaatacaatcctggaagatattcagaaatctctg
gatatgtatttagagaccaagcgacatattttcccccgcttctacttcttgtccaatgat
gacctgctggagattctgggccagtcccgaaacccagaggctgtgcagccacacctcaaa
aaatgctttgacaacatcaagttgctgagaatccagaaggttggagggcccagcagcaaa
tgggaagctgtggggatgttctcgggcgacggcgagtacattgacttcctccactcagta
tttttagaaggccctgtggagtcctggcttggcgatgtggaacagaccatgagggtgacc
ctgcgggaccttctccggaactgccacctggccctcaggaagttcctcaacaagagggac
aaatgggtgaaggagtgggctggccaggtggtgatcactgccagtcagatccagtggacg
gctgatgtcaccaagtgcctgctgacagcgaaggagcgggcagacaagaaaatcctcaag
gtcatgaagaagaaccaggtgtcaatcctgaataagtattcagaagccatcagggggaac
ttgaccaagatcatgcggcttaaaattgtggctctggtgacgatagaaattcatgcccgg
gatgtgttggagaagctttacaagagtggcctcatggatgtcaattcctttgactggctc
agccaacttcggttctactgggagaaggatcttgatgactgtgtcatccgccagaccaac
acgcaatttcagtataattatgagtacttgggtaactcgggccggctcgtcatcaccccc
ctgacggacaggtgttacatgacactgaccacggcattgcacctgcaccgagggggctcc
cccaaaggccctgcaggcacaggcaagaccgagaccgtcaaggacctgggcaaggccctg
ggcatatatgtcattgtggtcaactgctctgagggcctggactacaagtccatgggccga
atgtactcaggtctggcccagactggagcttggggctgctttgatgagtttaaccgcatc
aacatcgaggtgctgtcagtggtggcccaccagatcctgtgcatcctgtctgccctggct
gccggcctcacccatttccattttgatggctttgaaataaatctggtgtggtcctgtggg
atcttcattaccatgaatcctggctatgctggccgcacagagcttcccgaaaatcttaaa
tccatgttccgcccaattgccatggtggtgcctgactccaccctcattgcagaaatcatt
ctctttggagagggctttggcaactgcaagattctggccaagaaggtgtacacactctac
tcactggctgtgcagcagctgtccagacaggaccactatgactttggcctgcgtgccctc
acctcccttctgcgctatgctggcaagaagcgccgcctacagccggatctgactgatgaa
gaggttctgctgctctcaatgagagatatgaacatcgccaagctcacttcagttgatgca
cccctgttcaatgccatcgtgcaagatctgtttcccaacattgagctgcctgtcattgac
tatggcaagctgcgggagaccgttgagcaggagattcgagacatgggcctgcaaagcacg
ccgttcaccctcaccaaggttttccagttgtatgaaaccaagaactcccgccactccacc
atgatcgtgggctgcacgggcagcggcaagactgcctcatggcgcattctacaggcctcc
ctgtcctctctgtgccgcgccggagaccctaacttcaacattgttagagagttccctttg
aaccccaaggcattgtccctaggggaactgtatggggaatatgacctcagcaccaatgaa
tggacagatggcatcttgtccagtgtcatgcggacggcatgtgcagatgagaaacccgac
gagaagtggatcctgttcgatggccccgtggacacactgtggatcgagaacatgaactcc
gtcatggacgataacaaggtgttgaccctcatcaacggcgagcgcatcgcgatgcccgag
caggtgtctctcctgtttgaagtggaggacctggcaatggcctctccggccactgtatcc
cgctgcgggatggtctacactgactacgctgacctgggctggaagccctatgttcagtca
tggctggagaagaggccaaaggctgaggtggagccccttcaacgcatgttcgaaaagctc
atcaacaagatgctggcctttaagaaggacaactgcaaggagctggtgcccctgcccgag
tacagcggtatcacctccctctgcaagctgtactctgccctggccacgccagagaatggg
gtgaacccagctgacggcgagaactatgtcaccatggtagagatgacatttgtgttcagc
atgatctggtctgtgtgtgcctctgtggatgaggagggccggaagaggatcgacagctac
ctccgagagatcgagggctcctttcccaataaggacacggtatatgagtattttgtggac
cccaaaatacggagttggacatcatttgaggacaagctccctaagagttggcgctaccct
ccaaacgcccccttctataagatcatggtgcccaccgtcgacactgttcgctacaactac
ctggtgagcagcttggtggccaaccagaatcccattctgctggtgggtcccgtggggact
gggaagacctccatcgcccagagcgttctgcagtccctgccctccagccagtggtcggtg
ctcgttgtcaacatgtccgcacagaccacatccaataacgtgcagagcatcattgagagc
agggttgagaagcgaaccaagggtgtctacgtgccattcgggggcaaaagcatgatcacc
tttatggatgacctaaatatgcccgctaaggacatgtttgggtcccagccacccctggag
ctgatccgcctctggattgactatggcttctggtatgaccgtacgaagcagaccatcaag
tacattcgagaaatgttcctgatggctgccatgggcccccctgggggtggacggactgtc
atctccccaaggctacggagtcgcttcaacattatcaacatgaccttccccacaaagtcc
cagatcatccgcatattcggcaccatgatcaatcagaagcttcaggactttgaggaagag
gtgaagcccattgggaacgtggtgacagaggccaccctggacatgtacaacaccgtggta
cagcgcttcctgcccacgcccaccaagatgcattacctcttcaaccttcgagacatctcc
aaggtgttccagggcatgcttagagccaacaaggacttccatgataccaagtccagcatc
acacggctctggatccatgaatgtttcagagtcttctctgaccggctggttgatgcggca
gacacagaagccttcatgggcatcataagcgacaagctcggctccttctttgacctcaca
tttcatcatctctgtcccagcaagcgtcctcctatctttggggatttcctgaaggagccc
aaggtgtatgaagacctcacggatctgacagtgctgaagacagtcatggagacagctcta
aatgagtataacctgtcaccctctgtcgtgcccatgcagctagtgctcttccgagaggct
attgaacacatcacacggatcgtgcgggtcattggacagcctcggggcaacatgctcctg
gtgggtatcgggggcagcggacgccagagtctggcccgcctggcttcatccatctgcgac
tacaccaccttccagatcgaggtcaccaaacattatcggaagcaggagttccgagatgat
atcaagcgtctgtatcgccaggctggggtggagctcaagaccacgtccttcatttttgtg
gacacccaaatagctgatgagtccttcctagaggacatcaacaacatcctcagctcaggc
gaggtgcccaatctctacaagcctgatgaatttgaagagatccagtcgcatatcatagac
caggcccgggtggagcaggtgcctgagtcatcggacagcctcttcgcctacctcattgaa
cgcgtgcagaacaacctgcacatcgtgctctgcctcagccccatgggggatcccttcagg
aactggatccgccagtacccagccttggtgaactgcacaaccatcaactggttctcagag
tggccccaagaggccctgctcgaggtggctgagaagtgcctcataggagtagacctggga
actcaggagaatatccacaggaaggtggcccagatctttgtcactatgcactggtcagta
gctcagtattcccagaagatgctgttggaactgcggagacacaactatgtcacacccacc
aaatacctggaactcctgtctggatataagaagttgctgggagaaaaacggcaggagctg
ctggcccaagccaataaactgcggacaggcttgttcaagatcgacgaaactagggaaaag
gtgcaagtgatgtcgttggagctggaggatgccaagaagaaggtggctgagttccagaag
cagtgtgaggagtacctggtcatcattgtgcagcagaagcgggaggcagatgagcagcag
aaggccgtaacagccaacagtgaaaagattgcagttgaggaaatcaagtgtcaggcactg
gctgacaatgcccagaaagatctagaagaggcactgcccgccctggaagaggccatgcgg
gccctggagtctctgaacaagaaggatataggagagatcaagtcttatggacggccccca
gcccaagtggagatagtgatgcaggcagttatgattcttcgaggcaacgagcccacatgg
gcagaggccaagaggcagctaggggaacagaacttcatcaagtcactgatcaactttgat
aaagacaatatctcagataaggttctgaagaagattggggcctactgcgcccagcctgac
ttccagcctgatatcatcggccgcgtctccctggctgccaagtccctctgcatgtgggtg
cgggccatggagctgtatgggcggctatatcgggtggtggagcccaagcgaatccgaatg
aacgctgccttggctcagcttcgggagaagcaagccgcgctcgctgaggcccaggagaag
ctgcgggaggtagctgagaaactggagatgctaaagaaacagtatgatgagaagctggca
cagaaggaggagcttcgcaagaagtctgaagagatggagctgaagctggagcgagctggg
atgctcgtgtcggggttggctggcgagaaggccagatgggaggagacagtccagggcctg
gaggaggacctgggctacctggtgggggactgtctcctggcagctgccttcctgtcctac
atgggacccttcctgaccaactaccgggatgagattgtcaaccaaatctggatcgggaag
atctgggagcttcaggttccttgctccccttctttcgccatcgataacttcctgtgcaat
cctaccaaagtccgggactggaacatccaagggttgccctcagacgccttctccactgag
aatggcatcatcgtcacccgaggcaacaggtgggcactgatgatcgaccctcaggcccag
gccctgaaatggattaagaacatggaaggaggccagggcctgaagatcatcgacctgcag
atgagcgattacctgcgaatcctagaacacgccattcactttggatacccggtgctactt
cagaacgtgcaggaatatctggaccccacactgaaccccatgctcaacaaatctgtagcc
cgaatcggtggtcggctgttgatgcgcattggcgataaggaggtggaatataataccaat
ttccgtttctacatcaccaccaagctctccaacccccactacagcccagagacctcagcc
aagaccaccatcgtcaactttgctgttaaagaacagggcctggaggcccagctgctgggc
attgtggtgcggaaggagcggcctgagctggaggagcagaaggactcactggtcatcaac
atcgcggctggtaaaaggaagctcaaggagctggaggatgagatcctgcggctgctgaat
gaggccaccggctccctgctggatgatgtgcagctggtgaacacgctgcatacctccaag
atcacagccacagaggtgactgagcagctggagaccagtgagaccacagagatcaacact
gacttggcgcgggaggcttaccgcccatgcgcccagcgggcatcaatcctgttcttcgtg
ctcaatgatatgggctgcatcgaccccatgtaccagttctcactggatgcctacatcagc
ctctttattctcagcattgacaaaagccaccgcagcaataagctggaggaccgcattgac
tacctgaatgactaccacacctacgctgtctacaggtacacctgccgtacccttttcgaa
cgccacaaactactattcagttttcatatgtgtgccaaaatcttggagacttctggcaag
ctcaacatggatgaatacaacttctttctacgtgggggtgtggtcttggatcgggagggc
caaatggacaatccatgtagtagctggcttgcagatgcctactgggataacatcacagag
ctagacaaactgaccaacttccacggactcatgaactcctttgagcagtaccctcgtgac
tggcacctgtggtataccaatgctgccccggagaaggcgatgctgccaggtgagtgggaa
aatgcctgcaatgaaatgcaacggatgctgatcgttcgctccctgcgccaggaccgcgtg
gccttctgcgtgacctccttcatcatcaccaaccttggctcccgcttcatcgagccgcct
gtgctgaatatgaagtcggtgctggaggattcaaccccacgatccccactcgtgttcatc
ctgtcccctggtgtggaccccaccagtgccctgctgcagctggcagagcacatgggcatg
gcccagcgcttccacgccctgtccctgggccagggccaggcccccatcgctgctcggctc
ctccgagagggtgtgactcagggacactgggtgttcctggcaaactgccacctgtcactg
tcttggatgcctaatctggacaagctggtggagcagctgcaggtggaggatcctcatcca
tccttccgcctctggctcagctccatcccccacccagacttccctatctcaatcttgcag
gtcagcatcaagatgaccacagagccaccaaagggcctaaaggccaacatgacacgtctt
taccaactgatgtcagaaccacagttttcccgctgctccaaacctgccaaatataagaag
ctgctgttttcactctgtttcttccactctgtgttacttgaacgcaaaaagttcctgcag
cttggctggaacatcatctatggcttcaatgactccgactttgaggtgtcagaaaacttg
ctgagcctctatctcgatgagtacgaggagacaccttgggacgcacttaagtacctcatt
gccggcatcaactatggtggacatgtcacagatgactgggaccggcgcctgctgaccacc
tacatcaatgattatttctgtgaccagtctctatcaactcccttccaccggttgtcagca
ctggagacttatttcatccccaaggatggcagcctcgcttcttacaaggaatacatcagc
ttattgcctggcatggacccccctgaggcctttggccagcaccccaatgctgatgtggcc
tctcagatcactgaggcacaaaccctctttgatactttgctttccttgcaacctcagatt
acacccaccagggctggaggccagacccgggaagagaaggtccttgagttggccgctgat
gtgaagcagaagatccctgaaatgatcgactatgaggggactcaaaaactgctagctctc
gacccctcccccctcaatgtggtccttctgcaggagatccagagatacaacacactgatg
cagaccatcctgttctcactgacagacctagagaaaggcatccagggtctcatcgtcatg
tctacaagcctggaagagattttcaattgcatctttgatgcccatgttcctccgctctgg
ggaaaggcatacccctcacaaaagccattggctgcctggacccgggacttggccatgcgt
gtggagcagtttgagctgtgggccagccgggcccggcctcctgtgatcttctggttgtct
ggtttcacctttcccactggcttcctcactgctgtgctgcagtcttcagctcgccaaaac
aacgtttcagtggacagcctctcctgggagtttatcgtttccactgtggatgacagcaac
ctagtgtatccccccaaggatggtgtctgggtccggggcctgtacctggaaggtgctggc
tgggaccggaagaactcctgcttggtggaggcagagcccatgcagcttgtctgcctcatg
cccacgatccacttccggcctgcagagagccgcaagaagagcgccaagggcatgtactcc
tgcccctgctattactatcccaaccgggcaggcagctcagaccgagcctcctttgtcatc
ggcattgacctgcggtctggggccatgacacctgatcattggatcaagaggggcactgct
ctactcatgagcctggacagctga

DBGET integrated database retrieval system