KEGG   Homo sapiens (human): 1503
Entry
1503              CDS       T01001                                 
Symbol
CTPS1, CTPS, GATD5, GATD5A, IMD24
Name
(RefSeq) CTP synthase 1
  KO
K01937  CTP synthase [EC:6.3.4.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa01100  Metabolic pathways
hsa01232  Nucleotide metabolism
hsa01240  Biosynthesis of cofactors
Module
hsa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Disease
H00093  Combined immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    1503 (CTPS1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     1503 (CTPS1)
SSDB
Motif
Pfam: CTP_synth_N GATase Peptidase_C26 CbiA Transket_pyr
Other DBs
NCBI-GeneID: 1503
NCBI-ProteinID: NP_001896
OMIM: 123860
HGNC: 2519
Ensembl: ENSG00000171793
Pharos: P17812(Tbio)
UniProt: P17812
Structure
LinkDB
Position
1:40979696..41012565
AA seq 591 aa
MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFV
LDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDA
IQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHV
SLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQ
VICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCS
IALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQK
LCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDAN
STEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRH
RFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPY
FGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgaagtacattctggttactggtggtgttatatcaggaattggaaaaggaatcattgcc
agcagtgtgggcacaatactcaagtcatgtggtttacatgtaacttcaatcaaaattgac
ccctacattaacattgatgcaggaacattctctccttatgagcatggtgaggtttttgtg
ctggatgatggtggggaagtagaccttgacctgggtaactatgagcggttccttgacatc
cgcctcaccaaggacaataatctgaccactggaaagatataccagtatgtcattaacaag
gaacggaaaggagattacttggggaaaactgtccaagttgtccctcatatcacagatgca
atccaggagtgggtgatgagacaggcgttaatacctgtagatgaagatggcctggaacct
caagtgtgtgttattgagcttggtggaaccgtgggggacatagaaagcatgccctttatt
gaggccttccgtcagttccaattcaaggtcaaaagagagaacttttgtaacatccacgtc
agtctagttccccagccaagttcaacaggggaacagaagactaaacctacccagaatagt
gttcgggaacttagaggacttgggctttccccagatctggttgtatgcaggtgctcaaat
ccacttgacacatcagtgaaggagaaaatatcaatgttctgccatgttgagcctgaacaa
gtgatctgtgtccacgatgtctcatccatctaccgagtccccttgttgttagaggagcaa
ggggttgtagattattttcttcgaagacttgaccttcctattgagaggcagccaagaaaa
atgctgatgaaatggaaagagatggctgacagatatgatcgcttgctggagacctgctct
attgcccttgtgggcaaatacacgaagttctcagactcctatgcctctgtcattaaggct
ctggagcattctgcactggccatcaaccacaaattggaaatcaagtacatagattctgcg
gacttggagcccatcacctcgcaagaagagcccgtgcgctaccacgaagcttggcagaag
ctctgtagtgctcatggagtgctggttccaggaggatttggtgttcgaggaacagaagga
aaaatccaagcaattgcctgggctcggaatcagaaaaagccttttttgggcgtgtgctta
gggatgcagttggcagtggttgaattctcaagaaacgtgctgggatggcaagatgccaat
tctacagagtttgaccctacgaccagtcatcccgtggtcgtagacatgccagaacacaac
ccagggcagatgggcggaaccatgaggctgggcaagaggagaaccctgttccagaccaag
aactcagtcatgaggaaactctatggagacgcagactacttggaagagaggcaccgccac
cgatttgaggtgaatccagtctggaaaaagtgtttggaagaacaaggcttgaagtttgtt
ggccaagatgttgaaggagagagaatggaaattgtggagttagaagatcatccctttttt
gttggggttcagtaccaccctgagttcctgtccaggcctatcaagccctccccaccatac
tttggcctcctcctggcctctgtggggcggctctcacattacctccagaaaggctgcagg
ctctcacccagggacacctatagtgacaggagtggaagcagctcccctgactctgaaatc
accgaactgaagtttccatcaataaatcatgactga

KEGG   Homo sapiens (human): 56474
Entry
56474             CDS       T01001                                 
Symbol
CTPS2, GATD5B
Name
(RefSeq) CTP synthase 2
  KO
K01937  CTP synthase [EC:6.3.4.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa01100  Metabolic pathways
hsa01232  Nucleotide metabolism
hsa01240  Biosynthesis of cofactors
Module
hsa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    56474 (CTPS2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     56474 (CTPS2)
SSDB
Motif
Pfam: CTP_synth_N GATase Peptidase_C26 CbiA Transket_pyr DUF2469
Other DBs
NCBI-GeneID: 56474
NCBI-ProteinID: NP_001137474
OMIM: 300380
HGNC: 2520
Ensembl: ENSG00000047230
Pharos: Q9NRF8(Tbio)
UniProt: Q9NRF8 A0A024RC00
Structure
LinkDB
Position
X:complement(16587999..16712910)
AA seq 586 aa
MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFV
LNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDA
VQEWVMNQAKVPVDGNKEEPQICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHV
SLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQ
VICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICS
IALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEKITETEDPVKFHEAWQK
LCKADGILVPGGFGIRGTLGKLQAISWARTKKIPFLGVCLGMQLAVIEFARNCLNLKDAD
STEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRH
RFEVNPNLIKQFEQNDLSFVGQDVDGDRMEIIELANHPYFVGVQFHPEFSSRPMKPSPPY
LGLLLAATGNLNAYLQQGCKLSSSDRYSDASDDSFSEPRIAELEIS
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgaagtacatcctggtcacgggtggggtcatctcaggcattggtaaagggatcattgcc
agcagcattggaacgattctaaaatcatgtggactccgagttactgccataaaaatcgac
ccctatattaacatcgatgctggcactttttcaccttatgaacacggtgaagtcttcgtc
ttaaatgatggtggagaagttgatttagaccttggaaattatgaaagatttttggatatt
aatctttataaagacaacaatatcaccacggggaagatatatcagcatgtgatcaataaa
gagaggcgtggtgattacctggggaaaacagtgcaagttgtccctcacattactgatgct
gtccaggagtgggttatgaatcaagccaaggtgccggtggatggtaataaggaagagccc
caaatatgcgttattgagctgggaggcaccattggagacatcgaaggaatgccgtttgtg
gaggcgtttagacaattccagtttaaggcgaaaagagagaatttctgtaatatccacgtt
agccttgtcccacagctcagtgctaccggagaacaaaaaaccaaacccacccaaaacagc
gtccgcgcactgaggggtttaggcctgtctccagatctgattgtctgccgaagttcaacg
cccattgagatggccgtgaaggagaagatttctatgttttgtcacgtgaaccctgaacag
gtcatatgtatccatgatgtttcttccacataccgagttcctgtgcttttagaggaacaa
agcattgtgaaatattttaaggagagattgcacctgcccatcggtgattctgcaagtaat
ttgctttttaagtggagaaatatggctgacaggtatgaaaggttacagaaaatatgctcc
atagccctggttggcaaatacaccaagctcagagactgctacgcctctgtgttcaaagcc
ctggaacactcagccctggccatcaaccacaagttgaatctgatgtacatagactccatt
gatctggagaagatcactgaaaccgaggaccctgtgaaatttcatgaagcttggcagaag
ctatgcaaagctgatggtattcttgtgcctggaggctttggaatcagaggaacattggga
aaactccaggcgatttcttgggcaaggacaaagaagattccttttctgggagtttgtctt
gggatgcaactagcagtgatagagtttgcaagaaactgccttaacttgaaagatgctgat
tccacagagtttaggccaaatgccccagttcctctggtgattgatatgcccgagcacaac
cctggcaatttgggaggaacaatgagactgggaataagaagaactgttttcaaaactgaa
aattcaatattaaggaaactttatggtgatgttccttttatagaagaaagacacagacat
cggttcgaggtaaaccctaacctgatcaaacaatttgagcagaatgacttaagttttgta
ggtcaggatgttgatggagacaggatggaaatcattgaactggcaaatcatccttatttt
gttggtgtccagttccatcctgagttttcttctaggccgatgaagccttcccctccgtat
ctggggctgttacttgcagcaactgggaacctgaatgcctacttgcaacagggttgcaaa
ctgtcttccagtgatagatacagtgatgccagtgatgacagcttttcagagccaaggata
gctgagttggaaataagctga

DBGET integrated database retrieval system