KEGG   Homo sapiens (human): 1511
Entry
1511              CDS       T01001                                 

Gene name
CTSG, CATG, CG
Definition
(RefSeq) cathepsin G
  KO
K01319  cathepsin G [EC:3.4.21.20]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04142  Lysosome
hsa04613  Neutrophil extracellular trap formation
hsa04614  Renin-angiotensin system
hsa05146  Amoebiasis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1511 (CTSG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    1511 (CTSG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    1511 (CTSG)
  09152 Endocrine system
   04614 Renin-angiotensin system
    1511 (CTSG)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    1511 (CTSG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    1511 (CTSG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1511 (CTSG)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1511 (CTSG)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.20  cathepsin G
     1511 (CTSG)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   1511 (CTSG)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Others
   1511 (CTSG)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 1511
NCBI-ProteinID: NP_001902
OMIM: 116830
HGNC: 2532
Ensembl: ENSG00000100448
Vega: OTTHUMG00000140182
Pharos: P08311(Tchem)
UniProt: P08311
LinkDB
Structure
PDB: 
1CGH 1T32 1AU8 1KYN

Position
14q12
AA seq 255 aa
MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVL
TAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRR
NRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYD
PRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRT
TMRSFKLLDQMETPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgcagccactcctgcttctgctggcctttctcctacccactggggctgaggcaggggag
atcatcggaggccgggagagcaggccccactcccgcccctacatggcgtatcttcagatc
cagagtccagcaggtcagagcagatgtggagggttcctggtgcgagaagactttgtgctg
acagcagctcattgctggggaagcaatataaatgtcaccctgggcgcccacaatatccag
agacgggaaaacacccagcaacacatcactgcgcgcagagccatccgccaccctcaatat
aatcagcggaccatccagaatgacatcatgttattgcagctgagcagaagagtcagacgg
aatcgaaacgtgaacccagtggctctgcctagagcccaggagggactgagacccgggacg
ctgtgcactgtggccggctggggcagggtcagcatgaggaggggaacagatacactccga
gaggtgcagctgagagtgcagagggataggcagtgcctccgcatcttcggttcctacgac
ccccgaaggcagatttgtgtgggggaccggcgggaacggaaggctgccttcaagggggat
tccggaggccccctgctgtgtaacaatgtggcccacggcatcgtctcctatggaaagtcg
tcaggggttcctccagaagtcttcaccagggtctcaagtttcctgccctggataaggaca
acaatgagaagcttcaaactgctggatcagatggagacccccctgtga

DBGET integrated database retrieval system