KEGG   Homo sapiens (human): 152404
Entry
152404            CDS       T01001                                 
Symbol
IGSF11, BT-IgSF, BTIGSF, CT119, CXADRL1, Igsf13, VSIG3
Name
(RefSeq) immunoglobulin superfamily member 11
  KO
K06791  immunoglobulin superfamily, member 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    152404 (IGSF11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    152404 (IGSF11)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  CTX family
   152404 (IGSF11)
SSDB
Motif
Pfam: V-set Ig_3 ig Ig_2 I-set DUF2207 OPA3
Other DBs
NCBI-GeneID: 152404
NCBI-ProteinID: NP_001015887
OMIM: 608351
HGNC: 16669
Ensembl: ENSG00000144847
Pharos: Q5DX21(Tbio)
UniProt: Q5DX21
LinkDB
Position
3:complement(118900557..119146020)
AA seq 431 aa
MTSQRSPLAPLLLLSLHGVAASLEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWM
VTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQC
LVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEK
LDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNI
GLIAGAIGTGAVIIIFCIALILGAFFYWRSKNKEEEEEEIPNEIREDDLPPKCSSAKAFH
TEISSSDNNTLTSSNAYNSRYWSNNPKVHRNTESVSHFSDLGQSFSFHSGNANIPSIYAN
GTHLVPGQHKTLVVTANRGSSPQVMSRSNGSVSRKPRPPHTHSYTISHATLERIGAVPVM
VPAQSRAGSLV
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgacttctcagcgttcccctctggcgcctttgctgctcctctctctgcacggtgttgca
gcatccctggaagtgtcagagagccctgggagtatccaggtggcccggggtcagccagca
gtcctgccctgcactttcactaccagcgctgccctcattaacctcaatgtcatttggatg
gtcactcctctctccaatgccaaccaacctgaacaggtcatcctgtatcagggtggacag
atgtttgatggtgccccccggttccacggtagggtaggatttacaggcaccatgccagct
accaatgtctctatcttcattaataacactcagttatcagacactggcacctaccagtgc
ctggtcaacaaccttccagacatagggggcaggaacattggggtcaccggtctcacagtg
ttagttcccccttctgccccacactgccaaatccaaggatcccaggatattggcagcgat
gtcatcctgctctgtagctcagaggaaggcattcctcgaccaacttacctttgggagaag
ttagacaataccctcaaactacctccaacagctactcaggaccaggtccagggaacagtc
accatccggaacatcagtgccctgtcttcaggtttgtaccagtgcgtggcttctaatgct
attggaaccagcacctgtcttctggatctccaggttatttcaccccagcccaggaacatt
ggactaatagctggagccattggcactggtgcagttattatcattttttgcattgcacta
attttaggggcattcttttactggagaagcaaaaataaagaggaggaagaagaagaaatt
cctaatgaaataagagaggatgatcttccacccaagtgttcttctgccaaagcatttcac
actgagatttcctcctcggacaacaacacactaacctcttccaatgcctacaacagtcga
tactggagcaacaatccaaaagttcatagaaacacagagtcagtcagccacttcagtgac
ttgggccaatctttctctttccactcaggcaatgccaacataccatccatttatgctaat
gggacccatctggtcccgggtcaacataagactctggtagtgacagccaacagagggtca
tcaccacaggtgatgtccaggagcaatggctcagtcagtaggaagcctcggcctccacac
actcattcctacaccatcagccacgcaacactggaacgaattggtgcagtacctgtcatg
gtaccagcccagagtcgggccgggtccttggtatag

DBGET integrated database retrieval system