KEGG   Homo sapiens (human): 1639
Entry
1639              CDS       T01001                                 

Gene name
DCTN1, DAP-150, DP-150, P135
Definition
(RefSeq) dynactin subunit 1
  KO
K04648  dynactin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01158  Mutation-caused aberrant DCTN1 to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
H00856  Distal hereditary motor neuropathies
H00879  Perry syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    1639 (DCTN1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    1639 (DCTN1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    1639 (DCTN1)
   05016 Huntington disease
    1639 (DCTN1)
   05022 Pathways of neurodegeneration - multiple diseases
    1639 (DCTN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1639 (DCTN1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    1639 (DCTN1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    1639 (DCTN1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    1639 (DCTN1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     1639 (DCTN1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     1639 (DCTN1)
SSDB
Motif
Pfam: Dynactin CAP_GLY ATG17_like Filament
Other DBs
NCBI-GeneID: 1639
NCBI-ProteinID: NP_004073
OMIM: 601143
HGNC: 2711
Ensembl: ENSG00000204843
Vega: OTTHUMG00000129963
Pharos: Q14203(Tbio)
UniProt: Q14203 Q6MZZ3
LinkDB
Structure
PDB: 

Position
2p13.1
AA seq 1278 aa
MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGV
ILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKRE
GTDTTAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGASSSLGPSGSASAGELSS
SEPSTPAQTPLAAPIIPTPVLTSPGAVPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAE
DKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADT
ADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQL
KQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAE
STIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARE
TELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEA
SVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPG
GDHDCVLVLLLMPRLICKAELIRKQAQEKFELSENCSERPGLRGAAGEQLSFAAGLVYSL
SLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPL
TKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEATDI
ALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAV
LQEVAAAAAQLIAPLAENEGLLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTM
NKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLK
IKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQ
ADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGEEQQRGAIPGQAPGS
VPGPGLVKDSPLLLQQISAMRLHISQLQHENSILKGAQMKASLASLPPLHVAKLSHEGPG
SELPAGALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVE
KLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGFGQRH
RLVLTQEQLHQLHSRLIS
NT seq 3837 nt   +upstreamnt  +downstreamnt
atggcacagagcaagaggcacgtgtacagccggacgcccagcggcagcaggatgagtgcg
gaggcaagcgcccggcctctgcgggtgggctcccgtgtagaggtgattggaaaaggccac
cgaggcactgtggcctatgttggagccacactgtttgccactggcaaatgggtaggcgtg
attctggatgaagcaaagggcaaaaatgatggaactgttcaaggcaggaagtacttcact
tgtgatgaagggcatggcatctttgtgcgccagtcccagatccaggtatttgaagatgga
gcagatactacttccccagagacacctgattcttctgcttcaaaagtcctcaaaagagag
ggaactgatacaactgcaaagactagcaaactgcggggactgaagcctaagaaggcaccg
acagcccgaaagaccacaactcggcgacccaagcccacgcgcccagccagtactggggtg
gctggggccagtagctccctgggcccctctggctcagcgtcagcaggtgagctgagcagc
agtgagcccagcaccccggctcagactccgctggcagcacccatcatccccacgccggtc
ctcacctctcctggagcagtccccccgcttccttccccatccaaggaggaggagggacta
agggctcaggtgcgggacctggaggagaaactagagaccctgagactgaaacgggcagaa
gacaaagcaaagctaaaagagctggagaaacacaaaatccagctggagcaggtgcaggaa
tggaagagcaaaatgcaggagcagcaggccgacctgcagcggcgcctcaaggaggcgaga
aaggaagccaaggaggcgctggaggcaaaggaacgctatatggaggagatggctgatact
gctgatgccattgagatggccactttggacaaggagatggctgaagagcgggctgagtcc
ctgcagcaggaggtggaggcactgaaggagcgggtggacgagctcactactgacttagag
atcctcaaggctgagattgaagagaagggctcagatggcgctgcatccagttatcagctc
aagcagcttgaggagcagaatgcccgcctgaaggatgccctggtgaggatgcgggatctt
tcttcctcagagaagcaggagcatgtgaagctccagaagctcatggaaaagaagaaccaa
gagctggaagttgtgaggcaacagcgggagcgtctgcaggaggagctaagccaggcagag
agcaccattgatgagctcaaggagcaggtggatgctgctctgggtgctgaggagatggtg
gagatgctgacagatcggaacctgaatctggaagagaaagtgcgcgagttgagggagact
gtgggagacttggaagcgatgaatgagatgaacgatgagctgcaggagaatgcacgtgag
acagaactggagctgcgggagcagctggacatggcaggcgcgcgggttcgtgaggcccag
aagcgtgtggaggcagcccaggagacggttgcagactaccagcagaccatcaagaagtac
cgccagctgaccgcccatctacaggatgtgaatcgggaactgacaaaccagcaggaagca
tctgtggagaggcaacagcagccacctccagagacctttgacttcaaaatcaagtttgct
gagactaaggcccatgccaaggcaattgagatggaattgaggcagatggaggtggcccag
gccaatcgacacatgtccctgctgacagccttcatgcctgacagcttccttcggccaggt
ggggaccatgactgcgttctggtgctgttgctcatgcctcgtctcatttgcaaggcagag
ctgatccggaagcaggcccaggagaagtttgaactaagtgagaactgttcagagcggcct
gggctgcgaggagctgctggggagcaactcagctttgctgctggactggtgtactcgctg
agcctgctgcaggccacgctacaccgctatgagcatgccctctctcagtgcagtgtggat
gtgtataagaaagtgggcagcctgtaccctgagatgagtgcccatgagcgctccttggat
ttcctcattgaactgctgcacaaggatcagctggatgagactgtcaatgtggagcctctc
accaaggccatcaagtactatcagcatctgtacagcatccaccttgccgaacagcctgag
gactgtactatgcagctggctgaccacattaagttcacgcagagtgctctggactgcatg
agtgtggaggtaggacggctgcgtgccttcttgcagggtgggcaggaggctacagatatt
gccctcctgctccgggatctggaaacttcatgcagtgacatccgccagttctgcaagaag
atccgaaggcgaatgccagggacagatgctcctgggatcccagctgcactggcctttgga
ccacaggtatctgacacgctcctagactgcaggaaacacttgacgtgggtcgtggctgtg
ctgcaggaggtggcagctgctgctgcccagctcattgccccactggcagagaatgagggg
ctacttgtggctgctctggaggaactggctttcaaagcaagcgagcagatctatgggacc
ccctccagcagcccctatgagtgtctgcgccagtcatgcaacatcctcatcagtaccatg
aacaagctggccacagccatgcaggagggggagtatgatgcagagcggccccccagcaag
cctccaccggttgaactgcgggctgctgcccttcgtgcagagatcacagatgctgaaggc
ctgggtttgaagctcgaagatcgagagacagttattaaggagttgaagaagtcactcaag
attaagggagaggagctaagtgaggccaatgtgcggctgagcctcctggagaagaagttg
gacagtgctgccaaggatgcagatgagcgcatcgagaaagtccagactcggctggaggag
acccaggcactgctgcgaaagaaggagaaagagtttgaggagacaatggatgcactccag
gctgacatcgaccagctggaggcagagaaggcagaactaaagcagcgtctgaacagccag
tccaaacgcacgattgagggactccggggccctcctccttcaggcattgctactctggtc
tctggcattgctggtgaagaacagcagcgaggagccatccctgggcaggctccagggtct
gtgccaggcccagggctggtgaaggactcaccactgctgcttcagcagatctctgccatg
aggctgcacatctcccagctccagcatgagaacagcatcctcaagggagcccagatgaag
gcatccttggcatccctgccccctctgcatgttgcaaagctatcccatgagggccctggc
agtgagttaccagctggagcgctgtatcgtaagaccagccagctgctggagacattgaat
caattgagcacacacacgcacgtagtagacatcactcgcaccagccctgctgccaagagc
ccgtcggcccaacttatggagcaagtggctcagcttaagtccctgagtgacaccgtcgag
aagctcaaggatgaggtcctcaaggagacagtatctcagcgccctggagccacagtaccc
actgactttgccaccttcccttcatcagccttcctcagggccaaggaggagcagcaggat
gacacagtctacatgggcaaagtgaccttctcatgtgcggctggttttggacagcgacac
cggctggtgctgacccaggagcagctgcaccagcttcacagtcgcctcatctcctaa

DBGET integrated database retrieval system