KEGG   Homo sapiens (human): 1659
Entry
1659              CDS       T01001                                 
Symbol
DHX8, DDX8, Dhr2, HRH1, PRP22, PRPF22
Name
(RefSeq) DEAH-box helicase 8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    1659 (DHX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    1659 (DHX8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     1659 (DHX8)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Step II factors
    1659 (DHX8)
SSDB
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 AAA_19 Flavi_DEAD AAA_30 T2SSE PhoH AAA_16 Sigma54_activ_2 TsaE Presenilin
Other DBs
NCBI-GeneID: 1659
NCBI-ProteinID: NP_004932
OMIM: 600396
HGNC: 2749
Ensembl: ENSG00000067596
Pharos: Q14562(Tbio)
UniProt: Q14562 Q86YB2 Q05CV4
Structure
LinkDB
Position
17:43483975..43612083
AA seq 1220 aa
MAVAVAMAGALIGSEPGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKN
TTFDTFKASLVKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKDPVVKPKTEKEKLKELFP
VLCQPDNPSVRTMLDEDDVKVAVDVLKELEALMPSAAGQEKQRDAEHRDRTKKKKRSRSR
DRNRDRDRDRERNRDRDHKRRHRSRSRSRSRTRERNKVKSRYRSRSRSQSPPKDRKDRDK
YGERNLDRWRDKHVDRPPPEEPTIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISEL
RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNE
ETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKWEIKQMIAANVLSKEEFPDFD
EETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQS
ALAKERRELKQAQREAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEWKK
HAFGGNKASYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQ
YLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKY
MTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATL
DAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFL
TGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATN
IAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCY
RLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQ
LYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYR
PKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRK
QMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSA
LFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEP
LYNRYEEPNAWRISRAFRRR
NT seq 3663 nt   +upstreamnt  +downstreamnt
atggctgtggctgtagccatggcgggagccttaatcgggtcggagccaggccccgcggaa
gaacttgccaaactcgagtacctgtctttggtgtcaaaggtttgcactgagctggacaat
cacttggggatcaacgacaaggaccttgctgaatttgtgatcagtcttgctgagaaaaat
accacctttgatacttttaaggcttctctcgtcaaaaatggtgcagaatttacggattct
cttattagtaacttgctgcgtctcatacaaaccatgcggcctccagcgaagccttccact
agcaaagatccagttgttaaacctaaaacagaaaaagaaaagctgaaggaactcttccca
gtcctttgccaaccggacaacccttctgttcggaccatgttggatgaagatgatgtgaaa
gttgctgtggatgtcctgaaagaactggaagctttaatgcccagcgcagcaggccaggag
aagcaaagagatgctgaacaccgggacaggacaaagaagaagaagcggagtcgaagccga
gatcgaaaccgagatcgagacagagatagggaacgaaaccgagatagagaccacaagcgg
agacaccgatcccgctctcgatcacgttccaggacccgggagaggaataaagtgaagtct
agatatcggtccaggagcaggagtcagagtccccccaaagaccggaaggaccgggacaaa
tatggagagcggaatctggatagatggcgggataagcatgtggaccgccctcctccagaa
gagcccaccattggtgacatttataatggcaaagttaccagcatcatgcagtttggttgc
tttgtgcagctggaaggactaaggaagcggtgggaaggcctggtgcacatctctgagctc
cggcgggagggtcgtgtggccaatgtagctgatgtcgtgagcaaaggccagagggtcaaa
gtcaaagtgctgtccttcactgggaccaagaccagcctgagcatgaaggatgtggatcaa
gagactggagaagatctaaacccaaatagacggcgaaatcttgtcggggagaccaatgag
gagacctcaatgcggaatcctgatagacccactcacttgtcccttgtcagtgctcctgaa
gtagaggacgactcactggaacgcaagcgcctcacccgaatctctgacccagagaagtgg
gagatcaaacagatgattgctgccaatgtcctttccaaagaagaatttccagactttgat
gaagagactggcattctccctaaggtggatgatgaagaagatgaggaccttgagattgaa
ttggttgaggaagagcctccattcctgagagggcacactaagcaaagcatggacatgagc
cccattaaaattgtcaagaacccagacggctccctctcccaagcagcaatgatgcagagt
gccttggccaaagaaaggcgggaactcaaacaggcccagcgggaagctgagatggattct
attcccatgggactcaacaaacactgggttgaccctctgcctgatgcggaaggcagacag
attgctgccaacatgaggggtattgggatgatgcccaatgatattcctgagtggaagaag
catgcctttgggggcaacaaagcctcttacggaaaaaagacccagatgtcaatccttgag
cagagggagagcctgcccatctacaaactgaaggagcaattggtccaggccgtccatgac
aatcagatcctgattgtcattggtgagacaggatctggaaagacaacacagatcacccag
tacctggcggaggcaggctacacttccaggggcaagattgggtgtacccagcccagaaga
gtggcagctatgtcggtggccaaaagagtgtcagaggagtttggttgttgcttaggccaa
gaggtgggctacaccattcgatttgaggactgcactagccctgaaacagtcatcaagtac
atgacagatgggatgttgcttagagagtgcttgattgaccctgacctcactcagtacgcg
atcatcatgttggacgaggcacatgagaggacaattcacactgatgtgctctttggattg
ttgaaaaagacagttcagaaacggcaggacatgaagctgattgtcacctcagccaccttg
gatgcagtgaagttttctcaatacttctatgaagctcccattttcaccatcccaggtcga
acatatccagtggaaatactgtacacaaaggaacctgagacagattatctggatgccagc
ctgattactgttatgcagattcatttaacagaaccaccaggtgatatcctggtcttcctg
actggtcaggaagaaattgatactgcttgtgagatcctgtatgaaagaatgaaatccctg
ggacctgatgttccagagttaattatcctcccagtgtactctgctcttcccagtgagatg
cagacccgaatctttgacccagctccaccaggcagcagaaaggttgtgattgccaccaat
atcgcagagacatcgctgactattgatggtatctactatgtggtggacccaggattcgtg
aaacagaaagtttacaattccaagacagggattgaccagctcgtggtgacgcctatttct
caggctcaggcaaagcaacgagctggcagagctgggagaacaggcccagggaagtgttac
aggttgtacacagaacgtgcctaccgagatgaaatgctgaccaccaacgtgccggaaatc
cagagaaccaacttagcaagcacagtgctgtcactcaaggccatgggtatcaatgatctg
ctgtcctttgatttcatggatgccccacctatggaaactttgatcacagccatggagcag
ctgtacacactgggggccctggatgacgagggcctgctcactcgcttgggccgccggatg
gcagagttccctctggagccaatgctatgcaaaatgctcatcatgtctgtgcatctgggc
tgcagtgaggaaatgctgaccattgtatccatgctgtctgtgcagaacgtcttctatagg
cccaaggataaacaagcccttgcagatcagaagaaggccaaattccaccagactgaaggg
gaccacctcaccctgctagctgtgtacaactcctggaagaacaacaagttctccaaccca
tggtgctatgagaactttatccaggctcgttccctgcgccgggcccaggacattcgcaag
cagatgttaggcataatggacagacacaagctggatgttgtttcctgtggcaagtccaca
gtccgagtgcagaaggccatctgcagtgggttcttccgtaatgctgccaagaaagacccg
caggagggttaccggacactgatcgaccagcaggtggtctatatccatccttccagtgcc
ctcttcaacagacagccagaatgggtggtgtaccatgagctggtgctcaccaccaaggaa
tacatgcgtgaagttaccaccatcgaccctcggtggcttgtggagtttgccccagccttc
ttcaaggtctcagacccaactaagctaagcaaacagaagaagcaacagcgtcttgaaccc
ttgtacaaccgctatgaggaacccaatgcctggagaatatctcgagctttccgacggcgc
tga

DBGET integrated database retrieval system