KEGG   Homo sapiens (human): 166824
Entry
166824            CDS       T01001                                 
Symbol
RASSF6
Name
(RefSeq) Ras association domain family member 6
  KO
K09854  Ras association domain-containing protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    166824 (RASSF6)
   04392 Hippo signaling pathway - multiple species
    166824 (RASSF6)
SSDB
Motif
Pfam: RA Nore1-SARAH Phage_Orf51 RecO_C YusW Ras_bdg_2 TUG-UBL1 FNIP_M
Other DBs
NCBI-GeneID: 166824
NCBI-ProteinID: NP_958834
OMIM: 612620
HGNC: 20796
Ensembl: ENSG00000169435
Vega: OTTHUMG00000130007
Pharos: Q6ZTQ3(Tbio)
UniProt: Q6ZTQ3
LinkDB
Position
4:complement(73571550..73620631)
AA seq 369 aa
MLWEETGAAPAPARASDLPYRISSDHLKKEEKMTMMAHQYPSWIFINEKTFITREQLNSL
LKTYNIFYENQKNLHILYGETEDGKLIVEGMLDIFWGVKRPIQLKIQDEKPFSSFTSMKS
SDVFSSKGMTRWGEFDDLYRISELDRTQIPMSEKRNSQEDYLSYHSNTLKPHAKDEPDSP
VLYRTMSEAALVRKRMKPLMMDRKERQKNRASINGHFYNHETSIFIPAFESETKVRVNSN
MRTEEVIKQLLQKFKIENSPQDFALHIIFATGEQRRLKKTDIPLLQRLLQGPSEKNARIF
LMDKDAEEISSDVAQYINFHFSLLESILQRLNEEEKREIQRIVTKFNKEKAIILKCLQNK
LVIKTETTV
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgctctgggaggagacaggcgccgcccctgcgcccgcgcgggcctcggacctcccctac
aggatatcctcagaccatctcaaaaaggaggaaaagatgactatgatggctcaccagtac
ccctcttggatcttcattaatgagaagacattcataaccagggaacaacttaattcttta
ttgaagacctataacattttttatgagaaccagaaaaatctgcatattttatatggagag
actgaagatggcaaactaattgttgaaggaatgctggacattttctggggagtaaaacga
cctatacagctaaaaatacaagatgagaagccattctcttcttttactagtatgaagtca
tcagacgtcttctccagcaaaggaatgacacgctggggggaatttgacgatctctatcgt
attagtgagctggacaggacccagattcctatgtctgaaaaaaggaattcccaggaagac
tatttatcttatcacagcaacaccctgaagccacatgcaaaggatgaaccagactcccca
gtgctctatagaaccatgagtgaagcagctctggtgagaaaaaggatgaagcctctgatg
atggacagaaaagaaagacagaaaaatagagcctctattaatggacacttctataaccat
gaaacatcaattttcattccagcctttgaatcagaaactaaggtcagagtaaacagtaac
atgagaactgaagaagtaataaagcaacttctccaaaaatttaagattgaaaatagtccc
caggattttgctcttcacattatttttgcaacaggagaacaaagacgactaaagaagaca
gacattccgctactgcagaggctcctacagggaccttctgaaaagaatgctcgcattttc
ctcatggataaagatgcagaagaaattagcagtgatgtggctcagtacattaactttcac
ttttctctcttggaatccattcttcaaagattaaatgaagaagagaaaagagagattcaa
agaatagtaacaaaattcaataaagaaaaggcgattatactgaaatgtcttcaaaataaa
ctagtaataaaaacagagacaacagtttag

DBGET integrated database retrieval system