Homo sapiens (human): 1672 Help Entry 1672              CDS       T01001                                  Symbol DEFB1, BD1, DEFB-1, DEFB101, HBD1 Name (RefSeq) defensin beta 1   KO K23125   beta-defensin 1 Organism hsa  Homo sapiens (human) Pathway hsa02010   ABC transporters hsa05150   Staphylococcus aureus infection Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     1672 (DEFB1)  09160 Human Diseases   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     1672 (DEFB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:hsa02000]     1672 (DEFB1)    03037 Cilium and associated proteins [BR:hsa03037]     1672 (DEFB1) Transporters [BR:hsa02000]  Other transporters   Pores ion channels [TC:1]    1672 (DEFB1) Cilium and associated proteins [BR:hsa03037]  Motile cilia and associated proteins   Sperm associated proteins    1672 (DEFB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Defensin_beta Motif Other DBs NCBI-GeneID:  1672 NCBI-ProteinID:  NP_005209 OMIM:  602056 HGNC:  2766 Ensembl:  ENSG00000164825 CPD:  C16059 UniProt:  P60022 Structure PDBPDBj LinkDB All DBs Position 8:complement(6870592..6877936) Genome browser AA seq 68 aa AA seqDB search MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCY RGKAKCCK NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgagaacttcctaccttctgctgtttactctctgcttacttttgtctgagatggcctca ggtggtaactttctcacaggccttggccacagatctgatcattacaattgcgtcagcagt ggagggcaatgtctctattctgcctgcccgatctttaccaaaattcaaggcacctgttac agagggaaggccaagtgctgcaagtga

DBGET integrated database retrieval system