KEGG   Homo sapiens (human): 1739
Entry
1739              CDS       T01001                                 
Symbol
DLG1, DLGH1, SAP-97, SAP97, hdlg
Name
(RefSeq) discs large MAGUK scaffold protein 1
  KO
K12076  disks large protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04660  T cell receptor signaling pathway
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
Network
nt06114  PI3K signaling (viruses)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06166  Human papillomavirus (HPV)
nt06214  PI3K signaling
  Element
N00340  The Scribble/Dlg/Lgl polarity module
N00341  HPV E6 to the Scribble/Dlg/Lgl polarity module
N00502  HTLV-1 Tax to PTEN-PIP3-AKT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    1739 (DLG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    1739 (DLG1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    1739 (DLG1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    1739 (DLG1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    1739 (DLG1)
   05165 Human papillomavirus infection
    1739 (DLG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1739 (DLG1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    1739 (DLG1)
SSDB
Motif
Pfam: Guanylate_kin PDZ MAGUK_N_PEST L27_1 PDZ_6 PDZ_assoc PDZ_2 SH3_1 SH3_2 Peptidase_M50 SH3_9
Other DBs
NCBI-GeneID: 1739
NCBI-ProteinID: NP_001091894
OMIM: 601014
HGNC: 2900
Ensembl: ENSG00000075711
Pharos: Q12959(Tbio)
UniProt: Q12959
Structure
LinkDB
Position
3:complement(197042560..197299321)
AA seq 904 aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTL
LDNPKCIDRSKPSEPIQPVNTWEISSLPSSTVTSETLPSSLSPSVEKYRYQDEDTPPQEH
ISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVLPSPPTVPVIPVLP
VPAENTVILPTIPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAG
GTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAG
SIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAH
KDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDIT
NSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNI
VGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVT
IVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGL
PSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKF
NSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIIL
GPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIE
AGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIME
MNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVPA
KEKL
NT seq 2715 nt   +upstreamnt  +downstreamnt
atgccggtccggaagcaagatacccagagagcattgcaccttttggaggaatatcgttca
aaactaagccaaactgaagacagacagctcagaagttccatagaacgggttattaacata
tttcagagcaacctctttcaggctttaatagatattcaagaattttatgaagtgacctta
ctggataatccaaaatgtatagatcgttcaaagccgtctgaaccaattcaacctgtgaat
acttgggagatttccagccttccaagctctactgtgacttcagagacactgccaagcagc
cttagccctagtgtagagaaatacaggtatcaggatgaagatacacctcctcaagagcat
atttccccacaaatcacaaatgaagtgataggtccagaattggttcatgtctcagagaag
aacttatcagagattgagaatgtccatggatttgtttctcattctcatatttcaccaata
aagccaacagaagctgttcttccctctcctcccactgtccctgtgatccctgtcctgcca
gtccctgctgagaatactgtcatcctacccaccataccacaggcaaatcctcccccagta
ctggtcaacacagatagcttggaaacaccaacttacgttaatggcacagatgcagattat
gaatatgaagaaatcacacttgaaaggggaaattcagggcttggtttcagcattgcagga
ggtacggacaacccacacattggagatgactcaagtattttcattaccaaaattatcaca
gggggagcagccgcccaagatggaagattgcgggtcaatgactgtatattacgagtaaat
gaagtagatgttcgtgatgtaacacatagcaaagcagttgaagcgttgaaagaagcaggg
tctattgtacgcttgtatgtaaaaagaaggaaaccagtgtcagaaaaaataatggaaata
aagctcattaaaggtcctaaaggtcttgggtttagcattgctggaggtgttggaaatcag
catattcctggggataatagcatctatgtaaccaaaataattgaaggaggtgcagcacat
aaggatggcaaacttcagattggagataaacttttagcagtgaataacgtatgtttagaa
gaagttactcatgaagaagcagtaactgccttaaagaacacatctgattttgtttatttg
aaagtggcaaaacccacaagtatgtatatgaatgatggctatgcaccacctgatatcacc
aactcttcttctcagcctgttgataaccatgttagcccatcttccttcttgggccagaca
ccagcatctccagccagatactccccagtttctaaagcagtacttggagatgatgaaatt
acaagggaacctagaaaagttgttcttcatcgtggctcaacgggccttggtttcaacatt
gtaggaggagaagatggagaaggaatatttatttcctttatcttagccggaggacctgct
gatctaagtggagagctcagaaaaggagatcgtattatatcggtaaacagtgttgacctc
agagctgctagtcatgagcaggcagcagctgcattgaaaaatgctggccaggctgtcaca
attgttgcacaatatcgacctgaagaatacagtcgttttgaagctaaaatacatgattta
cgggagcagatgatgaatagtagtattagttcagggtcaggttctcttcgaactagccag
aagcgatccctctatgtcagagccctttttgattatgacaagactaaagacagtgggctt
cccagtcagggactgaacttcaaatttggagatatcctccatgttattaatgcttctgat
gatgaatggtggcaagccaggcaggttacaccagatggtgagagcgatgaggtcggagtg
attcccagtaaacgcagagttgagaagaaagaacgagcccgattaaaaacagtgaaattc
aattctaaaacgagagataaaggggagatccctgacgacatgggatcaaaaggcctgaag
catgtaacttctaatgccagcgatagtgaaagtagttaccgtggtcaagaagaatacgtc
ttatcttatgaaccagtgaatcaacaagaagttaattatactcgaccagtgatcatattg
ggacctatgaaagacaggataaatgatgacttgatctcagaatttcctgacaaatttgga
tcctgtgttcctcatacaactagaccaaaacgagattatgaggtagatggaagagattat
cattttgtgacttcaagagagcagatggaaaaagatatccaggaacataaattcattgaa
gctggccagtataacaatcatctatatggaacaagtgttcagtctgtacgagaagtagca
gaaaagggcaaacactgtatccttgatgtgtctggaaatgccataaagagattacagatt
gcacagctttaccctatctccatttttattaaacccaaatccatggaaaatatcatggaa
atgaataagcgtctaacagaagaacaagccagaaaaacatttgagagagccatgaaactg
gaacaggagtttactgaacatttcacagctattgtacagggggatacgctggaagacatt
tacaaccaagtgaaacagatcatagaagaacaatctggttcttacatctgggttccggca
aaagaaaagctatga

KEGG   Homo sapiens (human): 23513
Entry
23513             CDS       T01001                                 
Symbol
SCRIB, CRIB1, SCRB1, SCRIB1, Vartul, oSCRIB
Name
(RefSeq) scribble planar cell polarity protein
  KO
K16175  protein scribble
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06166  Human papillomavirus (HPV)
  Element
N00340  The Scribble/Dlg/Lgl polarity module
N00341  HPV E6 to the Scribble/Dlg/Lgl polarity module
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    23513 (SCRIB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    23513 (SCRIB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    23513 (SCRIB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    23513 (SCRIB)
SSDB
Motif
Pfam: PDZ PDZ_6 LRR_8 LRR_4 PDZ_2 Peptidase_M50 LRR_9
Other DBs
NCBI-GeneID: 23513
NCBI-ProteinID: NP_056171
OMIM: 607733
HGNC: 30377
Ensembl: ENSG00000180900
Pharos: Q14160(Tbio)
UniProt: Q14160 A0A0G2JNZ2
Structure
LinkDB
Position
8:complement(143790925..143815773)
AA seq 1630 aa
MLKCIPLWRCNRHVESVDKRHCSLQAVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLN
LRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRL
PDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLD
LGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPAELG
GLVLLTDLLLSQNLLRRLPDGIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENL
LMALPRSLGKLTKLTNLNVDRNHLEALPPEIGGCVALSVLSLRDNRLAVLPPELAHTTEL
HVLDVAGNRLQSLPFALTHLNLKALWLAENQAQPMLRFQTEDDARTGEKVLTCYLLPQQP
PPSLEDAGQQGSLSETWSDAPPSRVSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSE
LKVMKRSIEGRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVSEAEPEGPS
AEAQGGSQQEATTAGGEEDAEEDYQEPTVHFAEDALLPGDDREIEEGQPEAPWTLPGGRQ
RLIRKDTPHYKKHFKISKLPQPEAVVALLQGMQPDGEGPVAPGGWHNGPHAPWAPRAQKE
EEEEEEGSPQEEEEEEEEENRAEEEEASTEEEDKEGAVVSAPSVKGVSFDQANNLLIEPA
RIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKL
LEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERMVEPENAVTITPLRPEDDYSPRERR
GGGLRLPLLPPESPGPLRQRHVACLARSERGLGFSIAGGKGSTPYRAGDAGIFVSRIAEG
GAAHRAGTLQVGDRVLSINGVDVTEARHDHAVSLLTAASPTIALLLEREAGGPLPPSPLP
HSSPPTAAVATTSITTATPGVPGLPSLAPSLLAAALEGPYPVEEIRLPRAGGPLGLSIVG
GSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGDRILAVNGQDVRDATHQEAVSALLR
PCLELSLLVRRDPAPPGLRELCIQKAPGERLGISIRGGARGHAGNPRDPTDEGIFISKVS
PTGAAGRDGRLRVGLRLLEVNQQSLLGLTHGEAVQLLRSVGDTLTVLVCDGFEASTDAAL
EVSPGVIANPFAAGIGHRNSLESISSIDRELSPEGPGKEKELPGQTLHWGPEATEAAGRG
LQPLKLDYRALAAVPSAGSVQRVPSGAAGGKMAESPCSPSGQQPPSPPSPDELPANVKQA
YRAFAAVPTSHPPEDAPAQPPTPGPAASPEQLSFRERQKYFELEVRVPQAEGPPKRVSLV
GADDLRKMQEEEARKLQQKRAQMLREAAEAGAEARLALDGETLGEEEQEDEQPPWASPSP
TSRQSPASPPPLGGGAPVRTAKAERRHQERLRVQSPEPPAPERALSPAELRALEAEKRAL
WRAARMKSLEQDALRAQMVLSRSQEGRGTRGPLERLAEAPSPAPTPSPTPVEDLGPQTST
SPGRLSPDFAEELRSLEPSPSPGPQEEDGEVALVLLGRPSPGAVGPEDVALCSSRRPVRP
GRRGLGPVPS
NT seq 4893 nt   +upstreamnt  +downstreamnt
atgctcaagtgcatcccgctgtggcgctgcaaccggcacgtggagtcggtggacaagcgg
cactgttcgctgcaggccgtgccggaggagatctaccgctacagccgcagcctggaggag
ctgctgctcgacgccaaccagctgcgcgagctgcccaagccttttttccggctgctgaac
ttgcgcaagctgggcctgagcgacaacgagatccagcggttgcctcccgaggtggccaac
ttcatgcagctggtggagctggacgtgtcccggaacgatatccctgagatcccggagagc
atcaagttctgcaaggctctggagatcgcggacttcagcgggaaccccctctccaggctc
cctgatggcttcactcagctgcgcagcctggctcacctggccctgaatgatgtgtctctg
caggcactgcccggggacgtgggcaacctcgccaacctggtgaccctggagctccgggag
aacctgctcaagtccctgccagcgtccctgtcatttctggtcaagctggaacagctggat
ctgggaggcaacgatctggaagtgctgccagacactctgggggctctgcccaatcttcgg
gagctgtggcttgaccggaaccagctgtcagcactgcccccggagctcgggaacctgcgg
cgcctggtgtgcctggacgtgtcggaaaaccggctggaggagctgcctgctgagctcggc
gggctggtgctgctcactgacctgctgctgtcccagaacctgctgcggaggctgcccgac
ggcatcggtcagctgaagcagctatccatcctaaaggtagaccagaatcggctgtgcgag
gtgaccgaggccatcggggactgtgagaacctctctgagctgatcctcacggagaacctg
ctgatggccctgccccgctccctgggaaagctgactaagctgaccaacctcaacgtggac
cggaaccacctcgaggcgctgccgcccgagatcgggggctgtgtggcactcagcgtcctc
tccttgagggacaaccgcctggccgtcctgccaccagagctggcccacacgacagagctg
cacgtgctggacgtggcggggaaccgcctgcagagtctgccgttcgcgctcacccacctc
aatctcaaggccctgtggctggcagagaaccaggcgcagcccatgctccggttccagacg
gaggatgatgcccggaccggcgagaaggtgctcacctgctacttgctgccccagcagccc
ccacccagcctcgaggatgctgggcagcaggggagcctctcggagacctggagcgatgcc
ccgccgagccgcgtcagcgtcatccagttcctggaggcccccataggtgatgaggacgct
gaggaagctgcagctgagaagcggggcctacagcgccgggccacacctcaccccagcgag
ctcaaggtgatgaagaggagcatcgaggggcggcggagcgaggcctgcccttgccagcca
gactctgggtcgcccttgcctgcagaggaggagaagcggctgagtgccgagtctggcctg
agtgaagactctcgcccatctgccagcacagtctctgaggctgagcccgagggcccgtcg
gctgaggcacagggtgggagccagcaggaagccacgactgctggcggggaggaagacgcc
gaagaggactaccaggagcccacggtgcatttcgcagaggacgcactgctgcccggggat
gacagggagatcgaggaggggcagcctgaggccccctggaccctgccaggcgggaggcag
cggctcatccgcaaggacacacctcactacaaaaagcacttcaagatctccaagctgccc
cagcccgaggccgttgtggctctgctgcagggcatgcagcctgatggggagggccctgtg
gctcccgggggctggcacaatggcccccacgcaccctgggctcctcgggcccagaaggag
gaggaggaggaggaagagggtagtcctcaggaggaggaggaagaggaggaggaggaaaac
agggctgaagaggaagaggccagcactgaggaggaggacaaggagggggccgtggtttct
gcgccctctgtcaagggagtgtcgtttgaccaggccaataacctgctgatagagcctgct
cgcattgaggaggaagagctgaccctcactatcctgcggcagactgggggcctgggcatc
agcattgcgggcggcaagggctccacaccctataagggggacgacgagggcatattcatc
tctcgggtgtccgaggaaggccctgcggcccgggctggagtccgtgtgggtgacaagctc
ctggaggtgaatggtgtggctctgcagggcgccgagcaccacgaggccgtggaggcgctc
cggggggccggcactgccgtgcagatgcgagtgtggcgggagcgcatggtggagcctgag
aacgcggtcaccatcacgccgctgcggcccgaggatgattacagcccccgagagcggcgg
ggaggggggctgcgcctgcccctgctcccgcctgagagccccgggcccctccgtcagcgc
cacgtggcctgcctggcacgcagcgagagggggctgggcttcagcattgctggtgggaaa
ggctccacaccctacagggctggtgatgcgggcatcttcgtctcccgcattgccgagggc
ggtgctgctcaccgcgcgggcacactgcaggttggcgaccgcgtcctctctattaatgga
gtggacgtgactgaggccaggcatgaccacgccgtctccctgctgaccgctgcctccccc
accatcgccctgctgttggagcgggaggctgggggccctcttcctcccagccctctgcca
cattcctcaccccccaccgctgctgttgccaccaccagcataaccactgccacccccggg
gtgcctgggttgccgagcctggcccccagcctgctggctgccgcgttggaagggccatac
ccagtggaggagatccgtctgccaagagctgggggccctctggggcttagtattgtcgga
ggctccgaccattccagccacccgtttggtgtccaggagcctggtgtgttcatctccaag
gtgctcccgcggggcctggccgctcgcagcggcctgcgggttggggaccgcatcctggca
gtgaacgggcaagacgtgcgggatgccacgcaccaagaagcagtcagtgccctgctccgg
ccctgcctggagctgtcgctgctggtgcggagggacccggcacccccgggcctacgggaa
ctgtgcatccagaaggcacctggggagaggctgggcatcagcatccgcgggggtgccagg
ggccacgctggcaacccccgcgaccccacagacgagggcatcttcatctccaaggtgagc
cccacgggggcagccgggcgcgacggtcggctgcgtgtgggtttgcggctgttggaggtg
aaccagcagagcctgctgggcctgacgcacggcgaggcggtgcagctgctccgcagtgtg
ggcgacaccctcaccgtgctggtctgtgacggctttgaggccagcaccgacgcagccctg
gaggtgtccccaggtgtcattgccaacccctttgcggcaggcatcggccaccggaacagc
ctggagagcatctcttccatcgaccgggagctgagccctgagggcccaggcaaggagaag
gagctgcctggacagaccctgcactgggggcccgaggccacagaagccgcaggtcggggt
ctgcagcccctgaagctggactaccgcgccctggccgccgtgcccagcgctggcagcgtg
cagagggtaccgtctggagcagctggagggaagatggctgaatctccctgctcccctagt
ggccagcagccgccctccccgccttctccggatgagctgcccgccaatgtgaagcaggcc
tacagggccttcgcggccgtgcccacttctcacccgcctgaggatgcccctgcccagccc
cccacgcctgggcctgcagcctccccggagcagctgtccttccgggagcggcagaagtac
tttgagctggaggtgcgcgtgccccaggccgagggcccccctaagcgcgtgtccctggtg
ggtgctgacgacctgcggaagatgcaggaggaggaagccagaaaactacagcagaagaga
gcgcagatgctgcgggaggcggcagaggctggggccgaagcgaggctcgccctggacggg
gagacgctgggcgaggaggaacaggaggatgagcagccaccctgggccagcccgagcccc
acctcaaggcagagcccggcgtcccccccacccctgggaggtggcgccccggtgcggacg
gccaaagctgaacggcgccaccaggagcggctgcgcgtgcagagtccggagccaccggca
cccgagcgtgccctgtcccctgccgagctccgggccctggaggccgagaagcgtgcgctg
tggagggcagccaggatgaagtcattggaacaggacgctctccgagcacagatggtcctc
agcaggtcccaggaaggccggggcacgcgggggcccctggagcgactggccgaggcccct
tcccctgcgcccaccccgtcgcccacccctgtggaagacctcggcccccagaccagcacc
tccccgggacgcctgtcaccggactttgctgaggagttgaggtccctggaaccatctccc
agccctggcccgcaggaggaggatggagaagtggctctggtgcttctgggcaggccctca
cccggcgctgtgggccctgaagatgtggcactgtgcagcagccgccgccccgtaaggcct
gggcgccgtggcctgggccctgtgccctcctag

DBGET integrated database retrieval system