KEGG   Homo sapiens (human): 1896
Entry
1896              CDS       T01001                                 
Symbol
EDA, ECTD1, ED1, ED1-A1, ED1-A2, EDA-A1, EDA-A2, EDA1, EDA2, HED, HED1, ODT1, STHAGX1, TNLG7C, XHED, XLHED
Name
(RefSeq) ectodysplasin A
  KO
K05480  ectodysplasin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
Disease
H00625  Tooth agenesis
H00651  Hypohidrotic ectodermal dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    1896 (EDA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1896 (EDA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1896 (EDA)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Tumor necrosis fators
   1896 (EDA)
SSDB
Motif
Pfam: TNF Collagen
Other DBs
NCBI-GeneID: 1896
NCBI-ProteinID: NP_001390
OMIM: 300451
HGNC: 3157
Ensembl: ENSG00000158813
Pharos: Q92838(Tbio)
UniProt: Q92838
Structure
LinkDB
Position
X:69616113..70039472
AA seq 391 aa
MGYPEVERRELLPAAAPRERGSQGCGCGGAPARAGEGNSCLLFLGFFGLSLALHLLTLCC
YLELRSELRRERGAESRLGGSGTPGTSGTLSSLGGLDPDSPITSHLGQPSPKQQPLEPGE
AALHSDSQDGHQMALLNFFFPDEKPYSEEESRRVRRNKRSKSNEGADGPVKNKKKGKKAG
PPGPNGPPGPPGPPGPQGPPGIPGIPGIPGTTVMGPPGPPGPPGPQGPPGLQGPSGAADK
AGTRENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGT
YFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKI
AVKMVHADISINMSKHTTFFGAIRLGEAPAS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgggctacccggaggtggagcgcagggaactcctgcctgcagcagcgccgcgggagcga
gggagccagggctgcgggtgtggcggggcccctgcccgggcgggcgaagggaacagctgc
ctgctcttcctgggtttctttggcctctcgctggccctccacctgctgacgttgtgctgc
tacctagagttgcgctcggagttgcggcgggaacgtggagccgagtcccgccttggcggc
tcgggcacccctggcacctctggcaccctaagcagcctcggtggcctcgaccctgacagc
cccatcaccagtcaccttgggcagccgtcacctaagcagcagccattggaaccgggagaa
gccgcactccactctgactcccaggacgggcaccagatggccctattgaatttcttcttc
cctgatgaaaagccatactctgaagaagaaagtaggcgtgttcgccgcaataaaagaagc
aaaagcaatgaaggagcagatggcccagttaaaaacaagaaaaagggaaagaaagcagga
cctcctggacccaatggccctccaggacccccaggacctccaggaccccagggaccccca
ggaattccagggattcctggaattccaggaacaactgttatgggaccacctggtcctcca
ggtcctcctggtcctcaaggaccccctggcctccagggaccttctggtgctgctgataaa
gctggaactcgagaaaaccagccagctgtggtgcatctacagggccaagggtcagcaatt
caagtcaagaatgatctttcaggtggagtgctcaatgactggtctcgcatcactatgaac
cccaaggtgtttaagctacatccccgcagcggggagctggaggtactggtggacggcacc
tacttcatctatagtcaggtagaagtatactacatcaacttcactgactttgccagctat
gaggtggtggtggatgagaagcccttcctgcagtgcacacgcagcatcgagacgggcaag
accaactacaacacttgctataccgcaggcgtctgcctcctcaaggcccggcagaagatc
gccgtcaagatggtgcacgctgacatctccatcaacatgagcaagcacaccacgttcttt
ggggccatcaggctgggtgaagcccctgcatcctag

DBGET integrated database retrieval system