KEGG   Homo sapiens (human): 1960
Entry
1960              CDS       T01001                                 

Symbol
EGR3, EGR-3, PILOT
Name
(RefSeq) early growth response 3
  KO
K12497  early growth response protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04625  C-type lectin receptor signaling pathway
hsa05161  Hepatitis B
hsa05203  Viral carcinogenesis
Network
nt06140  Transcription (viruses)
nt06162  Hepatitis B virus (HBV)
nt06263  Hepatocellular carcinoma
  Element
N00532  HBV HBx to Egr-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    1960 (EGR3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    1960 (EGR3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    1960 (EGR3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1960 (EGR3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    1960 (EGR3)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 DUF3446 zf-C2HC_2 zf-BED zf-H2C2_5 zf-C2H2_6
Other DBs
NCBI-GeneID: 1960
NCBI-ProteinID: NP_004421
OMIM: 602419
HGNC: 3240
Ensembl: ENSG00000179388
Vega: OTTHUMG00000097825
Pharos: Q06889(Tbio)
UniProt: Q06889
LinkDB
Position
8p21.3
AA seq 387 aa
MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMATENVMDIGLT
NEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
STQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAK
PALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIH
PGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHT
GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKE
KKAEKGGAPSASSAPPVSLAPVVTTCA
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgaccggcaaactcgccgagaagctgccggtgaccatgagcagtttgctaaaccaactg
cctgacaatctgtaccccgaggagatccccagcgcgctcaacctcttctccggcagcagc
gactcggtagtccattacaatcagatggctacagagaatgtaatggacatcggtctgacc
aacgagaagcccaacccggaactctcttactccggctccttccagccagcccccggcaac
aagaccgtgacctacttgggaaagttcgccttcgactccccttccaactggtgccaggac
aacatcattagcctcatgagcgccggcatcttgggggtgcccccggcttcaggggcgctc
agcacgcagacgtccacggccagcatggtgcagccaccgcagggtgacgtggaggccatg
tatcccgcgctacccccctactccaactgcggcgacctctactcagagcccgtgtctttc
cacgacccccagggcaatcccgggctcgcctattccccccaggattaccaatcggccaag
ccggcgttggacagcaatctcttccccatgattcctgactacaacctctaccaccacccc
aacgacatgggctccattccggagcacaagcccttccagggcatggaccccatccgggtc
aacccgccccctattacccctctggagaccatcaaggcattcaaagacaagcagatccac
ccgggctttggcagcctgccccagccgccgctcaccctcaagcccatccggccccgcaag
taccccaaccggcctagcaagacaccgctccacgaacggccccacgcgtgcccggccgag
ggctgcgaccgccgtttcagccgttcggacgagctgacccggcacctgcgcatccacacg
ggccacaagcccttccagtgccggatctgcatgcggagcttcagccgcagcgaccacctc
accactcacatccgcactcatacgggcgagaagccctttgcctgcgagttctgcgggcgc
aagtttgcgcgcagcgacgagcgcaagcgccacgccaagatccacctcaagcaaaaggag
aagaaggcggagaagggcggtgcaccctctgcatcctcggcgccccccgtgtcgctggcc
cccgtggtcaccacctgcgcctga

DBGET integrated database retrieval system